Cyclophilin A Polyclonal antibody 10720-1-AP proteintech
$149.00
In stock
SKU
10720-1-AP
| Catalog Number | 10720-1-AP |
| Synonyms | PPIA, Cyclosporin A binding protein, Cyclosporin A-binding protein, CYPA, CYPH |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (2) |
| Reactivity | human, mouse, rat, pig, monkey |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, ELISA |
| Applications | WB, IHC, IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, C6 cells, Raji cells, HepG2 cells, K-562 cells, NIH/3T3 cells |
| Tested Applications — Positive IHC detected in | human colon cancer tissue, human placenta tissue, human tonsillitis tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, C6 cells, Raji cells, HepG2 cells, K-562 cells, NIH/3T3 cells |
| Positive IHC detected in | human colon cancer tissue, human placenta tissue, human tonsillitis tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1120 Product name: Recombinant human CYPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC005320 Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE Predict reactive species |
| Full Name | peptidylprolyl isomerase A (cyclophilin A) |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC005320 |
| Gene Symbol | PPIA |
| Gene ID (NCBI) | 5478 |
| RRID | AB_2237516 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62937 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for Cyclophilin A antibody 10720-1-AP | Download protocol |
| IF protocol for Cyclophilin A antibody 10720-1-AP | Download protocol |
| IHC protocol for Cyclophilin A antibody 10720-1-AP | Download protocol |
| WB protocol for Cyclophilin A antibody 10720-1-AP | Download protocol |
| human | WB,IHC,IF Virol Sin Cyclophilin A binds to AKT1 and facilitates the tumorigenicity of Epstein-Barr virus by mediating the activation of AKT/mTOR/NF-κB positive feedback loop Authors - Shuyu Xin KO Validated View Article |
| mouse | WB Brain Defective cyclophilin A induces TDP-43 proteinopathy: implications for amyotrophic lateral sclerosis and frontotemporal dementia Authors - Laura Pasetto KO Validated View Article |
| mouse,human | WB,IHC Inflamm Regen Testosterone upregulates glial cell line-derived neurotrophic factor (GDNF) and promotes neuroinflammation to enhance glioma cell survival and proliferation Authors - Kouminin Kanwore View Article |
| Citations | 49 |
| Dilutions | WB : 1:2000-1:10000 IHC : 1:50-1:500 IF/ICC : 1:50-1:500 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Cyclophilin A, also named as PPIA and Rotamase A, belongs to the cyclophilin-type PPIase family and PPIase A subfamily. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA forms a trimolecular complex with cyclophilin and calcineurins to inhibit calcineurin phosphatase activity. PPIA is incorporated into the virion of the type 1 human immunodeficiency virus (HIV-1) via a direct interaction with the capsid domain of the viral Gag polyprotein and is crucial for efficient viral replication. Protocols Product Specific Protocols FC protocol for Cyclophilin A antibody 10720-1-AP Download protocol IF protocol for Cyclophilin A antibody 10720-1-AP Download protocol IHC protocol for Cyclophilin A antibody 10720-1-AP Download protocol WB protocol for Cyclophilin A antibody 10720-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2.
Journal: Cell Res | Authors: Shaojun Zhang | Species: human | Application: WB - CGG repeat RNA G-quadruplexes interact with FMRpolyG to cause neuronal dysfunction in fragile X-related tremor/ataxia syndrome.
Journal: Sci Adv | Authors: Sefan Asamitsu | Species: mouse | Application: WB - Defective cyclophilin A induces TDP-43 proteinopathy: implications for amyotrophic lateral sclerosis and frontotemporal dementia
Journal: Brain | Authors: Laura Pasetto KO Validated | Species: mouse | Application: WB - Decoding distinctive features of plasma extracellular vesicles in amyotrophic lateral sclerosis.
Journal: Mol Neurodegener | Authors: Laura Pasetto | Species: human | Application: WB - Testosterone upregulates glial cell line-derived neurotrophic factor (GDNF) and promotes neuroinflammation to enhance glioma cell survival and proliferation
Journal: Inflamm Regen | Authors: Kouminin Kanwore | Species: mouse,human | Application: WB,IHC - Cyclophilin A binds to AKT1 and facilitates the tumorigenicity of Epstein-Barr virus by mediating the activation of AKT/mTOR/NF-κB positive feedback loop
Journal: Virol Sin | Authors: Shuyu Xin KO Validated | Species: human | Application: WB,IHC,IF - PDCD5 promotes substrate release from the TRiC complex in cilia and flagella.
Journal: Mol Cell | Authors: Huafang Wei | Species: mouse | Application: WB - CGG repeat RNA G-quadruplexes interact with FMRpolyG to cause neuronal dysfunction in fragile X-related tremor/ataxia syndrome.
Journal: Sci Adv | Authors: Sefan Asamitsu | Species: mouse | Application: WB - Defective cyclophilin A induces TDP-43 proteinopathy: implications for amyotrophic lateral sclerosis and frontotemporal dementia
Journal: Brain | Authors: Laura Pasetto | Species: mouse | Application: WB - Fusobacterium nucleatum drives gastric cancer metastasis via Gbp-CypA-NF-κB-mediated CXCL8 crosstalk between tumor cells and mast cells.
Journal: Cell Commun Signal | Authors: Xinyi Yang | Species: human | Application: WB - Integrated imaging and molecular profiling reveals APOE4-associated neurovascular and glial disruptions in young adult mice.
Journal: J Neuroinflammation | Authors: Yi Guan - Multi-omics reveals cholesterol-driven macrophage metabolic reprogramming and inflammation in chronic obstructive pulmonary disease.
Journal: Genome Med | Authors: Xinru Ran | Species: human, mouse | Application: WB - A single-cell atlas reveals the tumorigenesis and microenvironment status of primary tracheobronchial tumors.
Journal: NPJ Precis Oncol | Authors: Chen Shu | Species: human | Application: IF - Comprehensive single-cell RNA analysis reveals intertumoral microenvironment heterogeneity and hub niche of carcinogenesis in thyroid cancer.
Journal: NPJ Precis Oncol | Authors: Hao Xu | Species: human | Application: IHC - PARP3 promotes macrophage inflammation via mono ADP ribosylation of Ppia Glu140
Journal: Mol Med | Authors: Runjie Fan | Species: mouse | Application: WB - Testosterone upregulates glial cell line-derived neurotrophic factor (GDNF) and promotes neuroinflammation to enhance glioma cell survival and proliferation
Journal: Inflamm Regen | Authors: Kouminin Kanwore | Species: mouse,human | Application: WB,IHC - Discovery of Novel Oxazolo[4,3-f]purine Derivatives as Antitumor Agents through PPIA Interaction
Journal: J Med Chem | Authors: Xian-Jia Li | Species: human | Application: WB,IP - Cyclophilin A inhibits trophoblast migration and invasion in vitro and vivo through p38/ERK/JNK pathways and causes features of preeclampsia in mice.
Journal: Life Sci | Authors: Haoyue Hu | Species: human | Application: IF - Cyclophilin A inhibits trophoblast migration and invasion in vitro and vivo through p38/ERK/JNK pathways and causes features of preeclampsia in mice.
Journal: Life Sci | Authors: Haoyue Hu | Species: human | Application: IF - Spinal cord phosphoproteome of SCA2 mouse model reveals alteration of ATXN2-N-term PRM-SH3-actin interactome and of autophagy
Journal: Mol Cell Proteomics | Authors: Luis-Enrique Almaguer-Mederos | Application: WB - Cyclophilin A secreted from fibroblast-like synoviocytes is involved in the induction of CD147 expression in macrophages of mice with collagen-induced arthritis.
Journal: J Inflamm (Lond) | Authors: Nishioku Tsuyoshi T | Species: mouse | Application: WB,IHC - Cyclophilin A causes severe fever with thrombocytopenia syndrome virus-induced cytokine storm by regulating mitogen-activated protein kinase pathway
Journal: Front Microbiol | Authors: Huaying Huang | Species: human | Application: WB - Epstein-Barr Virus Nuclear Antigen 1 Recruits Cyclophilin A to Facilitate the Replication of Viral DNA Genome.
Journal: Front Microbiol | Authors: Shuyu Xin | Species: human | Application: WB - Virus specificity and nucleoporin requirements for MX2 activity are affected by GTPase function and capsid-CypA interactions
Journal: PLoS Pathog | Authors: Bailey Layish | Species: human | Application: WB - Virus specificity and nucleoporin requirements for MX2 activity are affected by GTPase function and capsid-CypA interactions
Journal: PLoS Pathog | Authors: Bailey Layish | Species: human | Application: WB - Beneficial effects of synthetic torpor in a fast-progressing mouse model of amyotrophic lateral sclerosis.
Journal: Exp Neurol | Authors: Stefano Fabrizio Columbro | Species: mouse | Application: WB - Cyclophilin A binds to AKT1 and facilitates the tumorigenicity of Epstein-Barr virus by mediating the activation of AKT/mTOR/NF-κB positive feedback loop
Journal: Virol Sin | Authors: Shuyu Xin | Species: human | Application: WB,IHC,IF - Effects of Lysine Deacetylation Inhibition Alone or in Combination With Arimoclomol on TDP-43 Proteinopathy.
Journal: J Neurochem | Authors: Serena Scozzari - Tacrolimus ameliorates podocyte injury by restoring FK506 binding protein 12 (FKBP12) at actin cytoskeleton
Journal: FASEB J | Authors: Hidenori Yasuda | Species: rat | Application: IF - CD147/EMMPRIN acts as a functional entry receptor for measles virus on epithelial cells.
Journal: J Virol | Authors: Watanabe Akira A | Species: mouse,human | Application: WB,IF - Hepatitis B virus (HBV) surface antigen interacts with and promotes cyclophilin a secretion: possible link to pathogenesis of HBV infection.
Journal: J Virol | Authors: Tian Xiaochen X | Species: mouse,human | Application: WB,IHC,IF - CD147/EMMPRIN acts as a functional entry receptor for measles virus on epithelial cells.
Journal: J Virol | Authors: Watanabe Akira A | Species: mouse,human | Application: WB,IF - Proteomic analysis of low dose arsenic and ionizing radiation exposure on keratinocytes.
Journal: Proteomics | Authors: Berglund Susanne R SR | Application: WB - Overexpression of Cyclophilin A in Human Periapical Lesions.
Journal: J Endod | Authors: Yanqing Wang | Species: human | Application: IF - Association of increased ligand cyclophilin A and receptor CD147 with hypoxia, angiogenesis, metastasis and prognosis of tongue squamous cell carcinoma.
Journal: Histopathology | Authors: Huang Congfa C | Species: human | Application: IHC - Proteomic analysis of hepatitis B surface antigen positive transgenic mouse liver and decrease of cyclophilin A.
Journal: J Med Virol | Authors: Chao Zhao | Species: mouse,human | Application: WB - Exosomal cyclophilin A as a novel noninvasive biomarker for Epstein-Barr virus associated nasopharyngeal carcinoma.
Journal: Cancer Med | Authors: Lingzhi Liu | Species: human | Application: WB - Identification and validation of necroptosis-related prognostic gene signature and tumor immune microenvironment infiltration characterization in esophageal carcinoma
Journal: BMC Gastroenterol | Authors: Kai Sun | Species: human | Application: IHC - Increased expression of peroxiredoxin 6 and cyclophilin A in squamous cell carcinoma of the tongue.
Journal: Oral Dis | Authors: Huang C-F CF | Species: human | Application: IHC - Construction and validation of a prognostic signature based on necroptosis-related genes in hepatocellular carcinoma
Journal: PLoS One | Authors: Yue-Ling Peng | Species: human | Application: IHC - Peptidylprolyl Isomerase a Regulates DNA Damage Repair and Serves as a Prognostic Biomarker in Lung Adenocarcinoma.
Journal: Dose Response | Authors: Li Zou - Clinical significance of keap1 and nrf2 in oral squamous cell carcinoma.
Journal: PLoS One | Authors: Cong-Fa Huang | Species: human | Application: IHC - Downregulation of Peptidylprolyl isomerase A promotes cell death and enhances doxorubicin-induced apoptosis in hepatocellular carcinoma.
Journal: Gene | Authors: Shaobing Cheng - Intron retention is a stress response in sensor genes and is restored by Japanese herbal medicines: A basis for future clinical applications.
Journal: Gene | Authors: Trieu-Duc Vu | Species: mouse | Application: WB - Oxaliplatin triggers necrosis as well as apoptosis in gastric cancer SGC-7901 cells.
Journal: Biochem Biophys Res Commun | Authors: Ping Wu | Species: human | Application: WB - Beta cell primary cilia mediate somatostatin responsiveness via SSTR3
Journal: Islets | Authors: Samantha E Adamson | Species: mouse | Application: WB - Correlation of five secretory proteins with the nasopharyngeal carcinoma metastasis and the clinical applications.
Journal: Oncotarget | Authors: Ya Tao | Species: human | Application: WB - Virus specificity and nucleoporin requirements for MX2 activity are affected by GTPase function and capsid-CypA interactions
Journal: bioRxiv | Authors: Bailey Layish | Species: human | Application: WB - Virus specificity and nucleoporin requirements for MX2 activity are affected by GTPase function and capsid-CypA interactions
Journal: bioRxiv | Authors: Bailey Layish | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
