| Catalog No. | Size | Price (USD) |
| rp166108-10μg | 10μg | $145.90 |
| rp166108-50μg | 50μg | $439.90 |
| rp166108-100μg | 100μg | $703.90 |
| rp166108-1mg | 1mg | $3,519.90 |
Product Information
| Product Name | Recombinant Cynomolgus DC-SIGN/CD209 Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 62-406 aa |
| Expressed Host | HEK293 |
| Accession | XP_015296329.1 |
| Amino Acids | 62-406 aa |
| Protein TAG | C-His |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Measured by the ability of the immobilized protein to support the adhesion of ICAM-3 expressing CHO Chinese hamster ovary cells. The ED50 for this effect is 1.25-8 μg/mL. |
| SDS Page | 41 - 52 kDa, under reducing conditions; 41 - 52 kDa, under non-reducing conditions. |
| Sequence | KVPSSLSQGQSKQDAIYQNLTQLKVAVSELSEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYEELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKQQEIYQELSRLKAAVGDLPEKSKQQEIYQKLTQLKAAVDGLPDRSKQQEIYQELIQLKAAVDLEGWTDTGIWTTSSEPSPDRPPPTERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSGDEERLLSPAPTTPNPPPEHHHHHH |
| Synonyms | CD209 antigendendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbingnon-integrin | CD209 molecule | CD209 | CDSIGNHIV gpl20-binding protein | CLEC4L | CLEC4LC-type lectin domain family 4 member L | DCSIGN | DC-SIGN | DC-SIGN1 | DC-SIGN1 |
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| X Filter Target ID | CD209 |
