The store will not work correctly when cookies are disabled.
Recombinant Human GRPEL1 Protein rp192123-10μg Aladdin
| Catalog No. | Size | Price (USD) |
| rp192123-10μg | 10μg | $279.90 |
| rp192123-50μg | 50μg | $799.90 |
| rp192123-100μg | 100μg | $1,279.90 |
| rp192123-1mg | 1mg | $7,399.90 |
Product Information
| Product Name | Recombinant Human GRPEL1 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His, 28-217 aa |
| Accession | Q9HAV7 |
| Amino Acids | 28-217 aa |
| Specifications & Purity | Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 25.3 kDa, under reducing conditions; 26.3 & 47.5 kDa, under non-reducing conditions |
| Sequence | MHHHHHHCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA |
| Synonyms | FLJ25609 | GREPEL 1 | GREPEL1 | GrpE like 1 | GrpE like 1 mitochondrial | GrpE like protein cochaperone | GrpE protein homolog 1 mitochondrial | GrpE protein homolog 1, mitochondrial | GRPE1_HUMAN | GRPEL 1 | Grpel1 | HMGE | Mt GrpE#1 | Mt-GrpE#1 |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
Copyright © 2025 Biogege, Inc. All rights reserved.
WhatsApp
