| Catalog No. | Size | Price (USD) |
| rp192042-10μg | 10μg | $79.90 |
| rp192042-50μg | 50μg | $239.90 |
| rp192042-100μg | 100μg | $389.90 |
| rp192042-1mg | 1mg | $2,139.90 |
Product Information
| Product Name | Recombinant Human KRAS (G12D) Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His tag, 2-185 aa (G12D) |
| Expressed Host | E. coli |
| Accession | P01116-2 |
| Amino Acids | 2-185 aa (G12D) |
| Protein TAG | N-His |
| Specifications & Purity | Carrier Free,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | The specific activity of KRAS was determined to be >3.0 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate. |
| SDS Page | 21.5 kDa, under reducing conditions; 21.5 kDa, under non-reducing conditions |
| Sequence | MHHHHHHTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC |
| Synonyms | C-K-RAS Protein | c-Ki-ras Protein | c-Ki-ras2 Protein | CFC2 Protein | K-Ras Protein | K-Ras 2 Protein | K-RAS2A Protein | K-RAS2B Protein | K-RAS4A Protein | K-RAS4B Protein | KI-RAS Protein | KRAS1 Protein | KRAS2 Protein | NS Protein | NS3 Protein | O |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
