| Catalog No. | Size | Price (USD) |
| rp176245-10μg | 10μg | $79.90 |
| rp176245-100μg | 100μg | $299.90 |
| rp176245-1mg | 1mg | $1,142.90 |
Product Information
| Product Name | Recombinant E.coli Thioredoxin1/trxA Protein |
| Short Description | Carreir Free, >90% (SDS-PAGE), E.coli, His tag, 1-109 aa |
| Expressed Host | E. coli |
| Accession | P0AA25 |
| Gene Symbol | trxA |
| Gene ID | 948289 |
| Amino Acids | 1-109 aa |
| Protein TAG | C-His & S |
| Form | Lyophilized |
| Specifications & Purity | Carrier Free,Azide Free,His-Tag,≥90%(SDS-PAGE) |
| SDS Page | 16.2 kDa, reducing conditions; 16.2 kDa, non-reducing conditions |
| Sequence | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTENLYFQ |
| Synonyms | Thioredoxin-1 | Trx-1 | trxA | fipA | tsnC | b3781 | JW5856 | ADF | ATL derived factor | ATL-derived factor | DKFZp686B1993 | MGC61975 | SASP | Surface associated sulphydryl protein | Surface-associated sulphydryl protein | testicular tissue protein Li 19 |
Product Description
Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55).
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
