Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active) CSB-MP855470HUh7 CUSABIO
$138.00
In stock
SKU
CSB-MP855470HUh7
Product Details
| Uniprot No. | Q8WTT0 |
| Alternative Names | Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 45-213aa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU)，the EC50 is 7.658-12.99 ng/mL. |
| Tag Info | N-terminal 6xHis-Myc-tagged |
| Form | Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Lead Time | 3-7 business days |
| Target Names | CLEC4C |
| Target Protein Sequence | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
| Mol. Weight | 24.1 kDa |
| Protein Length | Partial |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Datasheet & COA | Please contact us to get it. |
| Description | Recombinant human CLEC4C protein is generated through a mammalian cell expression system. The human CLEC4C gene fragment (45-213aa), coupled with an N-terminal 6xHis-tag gene, is integrated into a plasmid vector and then introduced into mammalian cells. Post-transfection, the cells undergo cultivation to facilitate protein expression. The resultant recombinant human CLEC4C protein is verified for purity exceeding 95% via SDS-PAGE. Its endotoxin content, measured using the LAL method, is confirmed to be under 1.0 EU/ug, ensuring high quality. The protein's interaction capability is evaluated using CLEC4C recombinant antibody (CSB-RA855470MA1HU), with the EC 50 of 7.658-12.99 ng/mL. CLEC4C is a novel plasmacytoid dendritic cell (pDC)-specific type II C-type lectin that mediates antigen capture and serves as an effective inhibitor of interferon-alpha/beta induction. It can also efficiently target ligands for antigen processing and peptide loading compartments to present to T cells. As the sole receptor expressed on pDCs, CLEC4C can reduce the production of inflammatory cytokines, including IFN-I, playing a significant regulatory role in the pathogenesis of lupus. In autoimmune diseases, beyond systemic lupus erythematosus, conditions like Sjögren's syndrome, alopecia areata, vitiligo, and polymyositis are also associated with CLEC4C. High levels of CLEC4C + pDCs have been identified in muscle fibers of patients with polymyositis, dermatomyositis, and other inflammatory myopathies. CLEC4C exhibits significant potential for the treatment of these diseases. Therefore, developing active CLEC4C protein can aid in clinical drug development and testing. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
