Recombinant Human Cystine/glutamate transporter (SLC7A11) (Active) CSB-CF892171HU(A4) CUSABIO
$1,040.00
In stock
SKU
CSB-CF892171HU(A4)
_product_image.jpg)
Product Details
| Uniprot No. | Q9UPY5 |
| Alternative Names | (Amino acid transport system xc-)(Calcium channel blocker resistance protein CCBR1)(Solute carrier family 7 member 11)(xCT) |
| Species | Homo sapiens (Human) |
| Source | in vitro E.coli expression system |
| Expression Region | 1-501aa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2 μg/mL can bind Anti-SLC7A11 recombinant antibody (CSB-RA892171MA1HU), the EC50 is 9.452-13.79 ng/mL. |
| Tag Info | N-terminal 10xHis-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Target Names | SLC7A11 |
| Research Area | Cell Biology |
| Target Protein Sequence | MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL |
| Mol. Weight | 58.2 kDa |
| Protein Length | Full Length |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Datasheet & COA | Please contact us to get it. |
| Description | SLC7A11 (xCT) is the light-chain subunit of system xc⁻, a cystine/glutamate antiporter critically implicated in ferroptosis regulation, redox homeostasis, and tumor metabolic reprogramming. This full-length recombinant human SLC7A11 (1–501 aa), produced in an *E. coli* cell-free system with an N-terminal 10×His tag, provides a suitable basis for studying this challenging multi-pass membrane transporter outside a lipid bilayer context. Functional ELISA confirms binding activity against a recombinant anti-SLC7A11 antibody (CSB-RA892171MA1HU) with an EC₅₀ of 9.452–13.79 ng/mL when immobilized at 2 μg/mL, and SDS-PAGE analysis demonstrates greater than 90% purity, supporting use in antibody validation, sandwich ELISA development, protein–antibody interaction studies, and as a reliable positive control in immunoassay optimization. Researchers should note that endotoxin levels have not been tested, so additional endotoxin removal may be necessary for any cell-based downstream applications. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
