CACNB3 Recombinant monoclonal antibody, PBS Only (Detector) 84762-2-PBS proteintech
$699.00
In stock
SKU
84762-2-PBS
| Catalog Number | 84762-2-PBS |
| Synonyms | CAB3, CACNB 3, CACNLB3 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag35651 Product name: Recombinant human CACNB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-484 aa of NM_000725.3 Sequence: EYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY Predict reactive species |
| Full Name | calcium channel, voltage-dependent, beta 3 subunit |
| Calculated Molecular Weight | 55kDa，484aa |
| GenBank Accession Number | NM_000725.3 |
| Gene Symbol | CACNB3 |
| Gene ID (NCBI) | 784 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P54284 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242088D6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
