CD9 Monoclonal antibody 60232-1-Ig proteintech
$149.00
In stock
SKU
60232-1-Ig
| Catalog Number | 60232-1-Ig |
| Synonyms | CD9 antigen, BTCC 1, BA2, 5H9 antigen, 5H9 |
| Host | Mouse |
| Reactivity | human and More (1) |
| Reactivity | human, rabbit |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, ELISA, PLA |
| Applications | WB, IHC, IF/ICC, IF-P, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | A431 cells, HeLa cells |
| Tested Applications — Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue, human colon cancer tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | human breast cancer tissue, human ovary tumor tissue, human lung cancer tissue |
| Tested Applications — Positive IF/ICC detected in | MCF-7 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Positive WB detected in | A431 cells, HeLa cells |
| Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue, human colon cancer tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue, human ovary tumor tissue, human lung cancer tissue |
| Positive IF/ICC detected in | MCF-7 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Tested Reactivity | human |
| Cited Reactivity | human, rabbit |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14529 Product name: Recombinant human CD9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-208 aa of BC011988 Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI Predict reactive species |
| Full Name | CD9 molecule |
| Calculated Molecular Weight | 228 aa, 25 kDa |
| Observed Molecular Weight | 23-27 kDa |
| GenBank Accession Number | BC011988 |
| Gene Symbol | CD9 |
| Gene ID (NCBI) | 928 |
| RRID | AB_11232215 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P21926 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CD9 antibody 60232-1-Ig | Download protocol |
| IHC protocol for CD9 antibody 60232-1-Ig | Download protocol |
| WB protocol for CD9 antibody 60232-1-Ig | Download protocol |
| human | WB Adv Sci (Weinh) Cancer Cell-Derived Large Extracellular Vesicles Promote Venous Thromboembolism by Activating NETosis Through Delivering CYBA Authors - Xiangji Li View Article |
| Guorong (Verified Customer) (03-22-2022) | Very weak bands with strong background were detected at 25 kDa Applications: Western Blot Primary Antibody Dilution: 1:5000 Cell Tissue Type: ARPE-19 CD9 Antibody Western Blot validation (1:5000 dilution) in ARPE-19 (Cat no:60232-1-Ig) |
| Citations | 175 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:1000-1:4000 IF-P : 1:200-1:800 IF/ICC : 1:400-1:1600 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 4H7B9 |
| Conjugation | Unconjugated |
The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). CD9 is also known as the p24 antigen besides MIC3, TSPAN29 because it is a protein of molecular weight 24 kD. The CD9 antigen appears to be a 227-amino acid molecule with 4 hydrophobic domains and 1 N-glycosylation site. Protocols Product Specific Protocols IF protocol for CD9 antibody 60232-1-Ig Download protocol IHC protocol for CD9 antibody 60232-1-Ig Download protocol WB protocol for CD9 antibody 60232-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- A functionally tunable magnetic nanochains platform for N-glycoproteomic analysis of extracellular vesicles from ultratrace biofluids
Journal: Nat Commun | Authors: Mingyang Li - Abnormal α-synuclein binds to synaptotagmin 13, impairing extracellular vesicle release in synucleinopathies
Journal: Transl Neurodegener | Authors: Yasuo Miki - 124I-labelled BMSC-Derived Extracellular Vesicles Deliver CRISPR/Cas9 Ribonucleoproteins With a GFP-Reporter System to Inhibit Osteosarcoma Proliferation and Metastasis
Journal: J Extracell Vesicles | Authors: Yujie Pan | Species: human | Application: WB - Extracellular vesicle biomarkers for complement dysfunction in schizophrenia
Journal: Brain | Authors: Ting Xue | Species: human | Application: WB - Cancer Cell-Derived Large Extracellular Vesicles Promote Venous Thromboembolism by Activating NETosis Through Delivering CYBA
Journal: Adv Sci (Weinh) | Authors: Xiangji Li | Species: human | Application: WB - POSTN-Mediated Interplay of M1 Polarized Macrophage with Tendon-Derived Stem Cells to Drive Traumatic Heterotopic Ossification Formation through PTK7/ATK Signaling
Journal: Adv Sci (Weinh) | Authors: Hang Liu - Pak4-mediated crosstalk between necroptotic macrophages and tendon stem/progenitor cells contributes to traumatic heterotopic ossification formation.
Journal: Bone Res | Authors: Ziyang Sun | Application: WB - Abnormal α-synuclein binds to synaptotagmin 13, impairing extracellular vesicle release in synucleinopathies
Journal: Transl Neurodegener | Authors: Yasuo Miki - WNT2B impairs endosomal trafficking via WASHC5 to inhibit autophagy: a novel non-secretory WNT pathway.
Journal: Autophagy | Authors: Danqiong Liu | Species: human | Application: WB - A functionally tunable magnetic nanochains platform for N-glycoproteomic analysis of extracellular vesicles from ultratrace biofluids
Journal: Nat Commun | Authors: Mingyang Li - An integrated single cell and spatial transcriptomic map of human white adipose tissue
Journal: Nat Commun | Authors: Lucas Massier | Species: human | Application: IF - Engineered Exosome-Mediated Near-Infrared-II Region V(2)C Quantum Dot Delivery for Nucleus-Target Low-Temperature Photothermal Therapy
Journal: ACS Nano | Authors: Yu Cao | Species: human | Application: WB - Dexamethasone-Integrated Mesenchymal Stem Cells for Systemic Lupus Erythematosus Treatment via Multiple Immunomodulatory Mechanisms
Journal: ACS Nano | Authors: Wenjuan Ma | Species: human | Application: WB - Neutrophil membrane engineered HucMSC sEVs alleviate cisplatin-induced AKI by enhancing cellular uptake and targeting
Journal: J Nanobiotechnology | Authors: Peipei Wu | Species: human | Application: WB - Microneedles combining delivery of hUMSC-derived exosomes and EGCG mitigate UV-induced skin damage.
Journal: J Nanobiotechnology | Authors: Chenhui He | Species: human | Application: WB - Ultrasound targeted microbubble destruction assisted exosomal delivery of siHmox1 effectively inhibits doxorubicin-induced cardiomyocyte ferroptosis
Journal: J Nanobiotechnology | Authors: Jianmei Chen | Application: WB - BPI overexpression suppresses Treg differentiation and induces exosome-mediated inflammation in systemic lupus erythematosus
Journal: Theranostics | Authors: Huai-Chia Chuang | Application: PLA - Plasma-derived DNA containing-extracellular vesicles induce STING-mediated proinflammatory responses in dermatomyositis.
Journal: Theranostics | Authors: Yubin Li | Species: human | Application: WB - CircWHSC1 promotes ovarian cancer progression by regulating MUC1 and hTERT through sponging miR-145 and miR-1182.
Journal: J Exp Clin Cancer Res | Authors: Zhi-Hong Zong | Species: human | Application: WB - 3D-hUMSCs Exosomes Ameliorate Vitiligo by Simultaneously Potentiating Treg Cells-Mediated Immunosuppression and Suppressing Oxidative Stress-Induced Melanocyte Damage
Journal: Adv Sci (Weinh) | Authors: Qi Wang | Species: human | Application: WB - POSTN-Mediated Interplay of M1 Polarized Macrophage with Tendon-Derived Stem Cells to Drive Traumatic Heterotopic Ossification Formation through PTK7/ATK Signaling
Journal: Adv Sci (Weinh) | Authors: Hang Liu - TEAD1 Enhances Exosome Secretion and Promotes Exosome-Mediated Tissue Regeneration.
Journal: Adv Sci (Weinh) | Authors: Yan Pu | Application: IF - Cancer Cell-Derived Large Extracellular Vesicles Promote Venous Thromboembolism by Activating NETosis Through Delivering CYBA
Journal: Adv Sci (Weinh) | Authors: Xiangji Li | Species: human | Application: WB - Urinary exosomes-based Engineered Nanovectors for Homologously Targeted Chemo-Chemodynamic Prostate Cancer Therapy via abrogating IGFR/AKT/NF-kB/IkB signaling.
Journal: Biomaterials | Authors: Shaojun Pan | Species: human | Application: WB - Extracellular vesicle biomarkers for complement dysfunction in schizophrenia
Journal: Brain | Authors: Ting Xue | Species: human | Application: WB - Neutrophil membrane engineered human umbilical cord MSC-derived sEVs enhance anti-tumor efficacy for gastric cancer via delivering pentraxin 3
Journal: J Control Release | Authors: Yuting Tang | Species: human | Application: WB - Fluorogenic RNA-based biomaterials for imaging and tracking the cargo of extracellular vesicles
Journal: J Control Release | Authors: Emily E Bonacquisti | Species: human | Application: IF - Locally delivered hydrogels with controlled release of nanoscale exosomes promote cardiac repair after myocardial infarction
Journal: J Control Release | Authors: Xi Tan | Application: WB - Single-cell RNA-sequencing data reveals the genetic source of extracellular vesicles in esophageal squamous cell carcinoma
Journal: Pharmacol Res | Authors: Bolun Zhou - Circulating small extracellular vesicle-encapsulated SEMA5A-IT1 attenuates myocardial ischemia-reperfusion injury after cardiac surgery with cardiopulmonary bypass
Journal: Cell Mol Biol Lett | Authors: Ting Wu | Species: human | Application: WB - BMSC-derived extracellular vesicles enhance osteosarcoma proliferation and metastasis via the circRNA-0010220/β-catenin pathway.
Journal: Cell Death Dis | Authors: Runsang Pan | Species: human | Application: WB - Single-cell RNA-sequencing data reveals the genetic source of extracellular vesicles in esophageal squamous cell carcinoma
Journal: Pharmacol Res | Authors: Bolun Zhou - Tumor exosomal circPTBP3 drives gastric cancer peritoneal metastasis via mesothelial-mesenchymal transition
Journal: Cell Death Dis | Authors: Chao Dong | Species: human | Application: WB - Ficolin B secreted by alveolar macrophage exosomes exacerbates bleomycin-induced lung injury via ferroptosis through the cGAS-STING signaling pathway
Journal: Cell Death Dis | Authors: Xu Wu | Application: WB - M1 macrophage-derived exosomes and their key molecule lncRNA HOTTIP suppress head and neck squamous cell carcinoma progression by upregulating the TLR5/NF-κB pathway.
Journal: Cell Death Dis | Authors: Huaili Jiang | Species: human | Application: WB - Circulating small extracellular vesicle-encapsulated SEMA5A-IT1 attenuates myocardial ischemia-reperfusion injury after cardiac surgery with cardiopulmonary bypass
Journal: Cell Mol Biol Lett | Authors: Ting Wu | Species: human | Application: WB - CD63+ cancer-associated fibroblasts confer CDK4/6 inhibitor resistance to breast cancer cells by exosomal miR-20
Journal: Cancer Lett | Authors: Jiahui Sun | Species: human | Application: WB - Single-cell dissection of cellular and molecular features underlying mesenchymal stem cell therapy in ischemic acute kidney injury
Journal: Mol Ther | Authors: Wenjuan Wang | Species: human | Application: WB - An Integrated Nanozyme-Exosome Platform for Multi-Targeted Therapy of Metabolic-Associated Steatotic Liver Disease.
Journal: Adv Healthc Mater | Authors: Kun Yu | Species: human | Application: WB - miR-150-5p in neutrophil-derived extracellular vesicles associated with sepsis-induced cardiomyopathy in septic patients
Journal: Cell Death Discov | Authors: Rongzong Ye | Species: human | Application: WB - Hypoxic TAM-derived exosomal miR-155-5p promotes RCC progression through HuR-dependent IGF1R/AKT/PI3K pathway.
Journal: Cell Death Discov | Authors: Wenyu Gu | Species: human | Application: WB - Apatinib enhances anti-PD-1 efficacy by inhibiting Exo70-mediated exosome secretion in pMMR/MSS colorectal cancer.
Journal: NPJ Precis Oncol | Authors: Lingying Zhao | Species: human | Application: WB - Caveolin-1 drives immunosuppression in esophageal squamous cell carcinoma by enhancing exosome secretion and macrophage M2 polarization via inhibition of MVB autophagic degradation.
Journal: J Transl Med | Authors: Ke-Rong Zhai | Species: human | Application: WB - Exosomes From Adipose-Derived Stem Cells Attenuate Adipose Inflammation and Obesity Through Polarizing M2 Macrophages and Beiging in White Adipose Tissues.
Journal: Diabetes | Authors: Hui Zhao | Application: WB - Septin 9 isoforms promote tumorigenesis in mammary epithelial cells by increasing migration and ECM degradation through metalloproteinase secretion at focal adhesions.
Journal: Oncogene | Authors: Jenna Marcus | Species: human | Application: WB - Macrophage exosomes transfer angiotensin II type 1 receptor to lung fibroblasts mediating bleomycin-induced pulmonary fibrosis.
Journal: Chin Med J (Engl) | Authors: Na-Na Sun | Application: WB - A nature-inspired nanoplatform for multi-protein targeted degradation via the autophagy-lysosome pathway.
Journal: Cell Chem Biol | Authors: Bide Tong | Species: human | Application: WB - Highly Sensitive Exosome Detection for Early Diagnosis of Pancreatic Cancer Using Immunoassay Based on Hierarchical Surface-Enhanced Raman Scattering Substrate.
Journal: Small Methods | Authors: Juan Li | Species: human | Application: WB - Comparative study on PD-L1/ALK dual-targeted biomimetic exosomes by two preparation approaches in pancreatic cancer.
Journal: Int J Biol Macromol | Authors: Chenyu Yuan - Highly Sensitive Exosome Detection for Early Diagnosis of Pancreatic Cancer Using Immunoassay Based on Hierarchical Surface-Enhanced Raman Scattering Substrate.
Journal: Small Methods | Authors: Juan Li | Species: human | Application: WB - Safety, Efficacy and Bio-Distribution Analysis of Exosomes Derived From Human Umbilical Cord Mesenchymal Stem Cells for Effective Treatment of Bronchopulmonary Dysplasia by Intranasal Administration in Mice Model
Journal: Int J Nanomedicine | Authors: Wanting Xu | Species: human | Application: WB - Functional exosomes modified with chitosan effectively alleviate anthracycline-induced cardiotoxicity
Journal: Int J Biol Macromol | Authors: Zhiwei Wen | Species: human | Application: WB - Plasma-derived exosome miR-10a-5p promotes premature ovarian failure by target BDNF via the TrkB/Akt/mTOR signaling pathway
Journal: Int J Biol Macromol | Authors: Zhiyuan Bao | Species: rabbit | Application: WB - CD44 promotes angiogenesis in myocardial infarction through regulating plasma exosome uptake and further enhancing FGFR2 signaling transduction
Journal: Mol Med | Authors: Qing Zhang | Application: IF - OGT-enriched Hepatocyte-derived Extracellular Vesicles Promote Capillarization of Liver Sinusoidal Endothelial Cells in Metabolic Dysfunction-associated Steatotic Liver Disease.
Journal: Cell Mol Gastroenterol Hepatol | Authors: Yanjin Wang | Species: human | Application: WB - SARS-CoV-2 spike protein enhances MAP4K3/GLK-induced ACE2 stability in COVID-19.
Journal: EMBO Mol Med | Authors: Huai-Chia Chuang | Species: human | Application: WB - Local Delivery of Dual Stem Cell-Derived Exosomes Using an Electrospun Nanofibrous Platform for the Treatment of Traumatic Brain Injury
Journal: ACS Appl Mater Interfaces | Authors: Jiaojiao Li | Application: WB - Exosomes derived from human adipose mesenchymal stem cells attenuate hypertrophic scar fibrosis by miR-192-5p/IL-17RA/Smad axis.
Journal: Stem Cell Res Ther | Authors: Yan Li | Species: human | Application: WB - Both Wnt signaling and epidermal stem cell-derived extracellular vesicles are involved in epidermal cell growth.
Journal: Stem Cell Res Ther | Authors: Ling Leng | Species: human | Application: WB - Small extracellular vesicles derived from lipotoxic hepatocytes transport FASN to promote hepatic stellate cell activation.
Journal: Hepatol Int | Authors: Yujie Shi | Species: mouse,human | Application: WB - Choline Phosphate Surface-Activated 3D-Printed Porous Titanium Scaffold Combined with Stem Cell Exosomes for Enhancing Bone Defects Repair
Journal: ACS Appl Mater Interfaces | Authors: Xuezhong Cui | Application: WB - CX3CR1hi macrophages sustain metabolic adaptation by relieving adipose-derived stem cell senescence in visceral adipose tissue
Journal: Cell Rep | Authors: Zixin Zhou | Species: human | Application: WB - Electroacupuncture-driven endogenous circulating serum exosomes as a potential therapeutic strategy for sepsis
Journal: Chin Med | Authors: Jingyu Zhang | Application: WB - The potential role of exosomal miRNAs and membrane proteins in acute HIV-infected people
Journal: Front Immunol | Authors: Xin Li | Species: human | Application: WB - miR-10a, miR-30c, and miR-451a encapsulated in small extracellular vesicles are pro-senescence factors in human dermal fibroblasts.
Journal: J Invest Dermatol | Authors: Jae Kyung Lee | Species: human | Application: WB - Engineered NK92 cell-derived exosomes inhibit ovarian cancer progression by degrading GPRC5A.
Journal: Front Immunol | Authors: Chaohua Si | Species: human | Application: WB - The potential role of exosomal miRNAs and membrane proteins in acute HIV-infected people
Journal: Front Immunol | Authors: Xin Li | Species: human | Application: WB - A Dual-Reporter Platform for Screening Tumor-Targeted Extracellular Vesicles.
Journal: Pharmaceutics | Authors: Masamitsu Kanada | Species: human | Application: WB - The lipid-metabolic enzyme HSD17B12 drives lysosomal degradation of PD-L1 potentiating anti-tumor immunity in a mouse model.
Journal: PLoS Biol | Authors: Zhihui Zhou | Species: human | Application: WB - Microfluidics-based label-free SERS profiling of exosomes with machine learning for osteosarcoma diagnosis
Journal: Talanta | Authors: Ying Jin | Species: human | Application: WB - SIX2-Mediated Microglial M2 Polarization and Exosomal miR-3470b Delivery Protect Dopaminergic Neurons in Parkinson's Disease.
Journal: CNS Neurosci Ther | Authors: Jia-shuo Kan | Application: WB - Transcriptome sequencing of circular RNA reveals the involvement of hsa-SCMH1_0001 in the pathogenesis of Parkinson's disease
Journal: CNS Neurosci Ther | Authors: Qiao Wang | Species: human | Application: WB - Blood-based CNS regionally and neuronally enriched extracellular vesicles carrying pTau217 for Alzheimer's disease diagnosis and differential diagnosis
Journal: Acta Neuropathol Commun | Authors: Zhen Guo | Application: WB - Loss of exosomal miR-200b-3p from hypoxia cancer-associated fibroblasts promotes tumorigenesis and reduces sensitivity to 5-Flourouracil in colorectal cancer via upregulation of ZEB1 and E2F3
Journal: Cancer Gene Ther | Authors: Wenjing Gong | Species: human | Application: WB - Enhancing Skin Injury Repair: Combined Application of PF-127 Hydrogel and hADSC-Exos Containing miR-148a-3p
Journal: ACS Biomater Sci Eng | Authors: Qiqi Zhang | Species: human | Application: WB - Hypoxic pancreatic stellate cell-derived exosomal mirnas promote proliferation and invasion of pancreatic cancer through the PTEN/AKT pathway.
Journal: Aging (Albany NY) | Authors: Wenpeng Cao | Species: human | Application: WB - Exosomal circRNAs contribute to intestinal development via the VEGF signalling pathway in human term and preterm colostrum.
Journal: Aging (Albany NY) | Authors: Yahui Zhou | Species: human | Application: WB - Circulating PD-L1 is associated with T cell infiltration and predicts prognosis in patients with CRLM following hepatic resection.
Journal: Cancer Immunol Immunother | Authors: Xiuxing Chen | Species: human | Application: WB - Circulating PD-L1 is associated with T cell infiltration and predicts prognosis in patients with CRLM following hepatic resection.
Journal: Cancer Immunol Immunother | Authors: Xiuxing Chen | Species: human | Application: WB - Immunological Microenvironment Diversity in Homogeneous and Non-Homogeneous Oral Leukoplakia.
Journal: Int J Mol Sci | Authors: Ingrīda Čēma - Proteomic and miRNA Profiles of Exosomes Derived from Myometrial Tissue in Laboring Women
Journal: Int J Mol Sci | Authors: Wenfeng Deng | Species: human | Application: WB - Exosome-Related FTCD Facilitates M1 Macrophage Polarization and Impacts the Prognosis of Hepatocellular Carcinoma
Journal: Biomolecules | Authors: Youyi Liu | Application: WB - Exosomes Derived from Hypoxia-Cultured Human Adipose Stem Cells Alleviate Articular Chondrocyte Inflammaging and Post-Traumatic Osteoarthritis Progression
Journal: Int J Mol Sci | Authors: Ling-Hua Chang | Species: human | Application: WB - Optimal Isolation Method of Small Extracellular Vesicles from Rat Plasma.
Journal: Int J Mol Sci | Authors: Kosuke Otani | Application: WB - Exosomal circZNF800 Derived from Glioma Stem-like Cells Regulates Glioblastoma Tumorigenicity via the PIEZO1/Akt Axis
Journal: Mol Neurobiol | Authors: Ning Zhang | Species: human | Application: WB - Exosomal miRNA Profiling in Liquid Biopsy of Vitreous in Proliferative Diabetic Retinopathy
Journal: Invest Ophthalmol Vis Sci | Authors: Bin Yan | Species: human | Application: WB - Down-expression of miR-494-3p in senescent osteocyte-derived exosomes inhibits osteogenesis and accelerates age-related bone loss via PTEN/PI3K/AKT pathway
Journal: Bone Joint Res | Authors: Chen Yao | Application: WB - Exosome-mediated delivery of miR-519e-5p promotes malignant tumor phenotype and CD8+ T-cell exhaustion in metastatic PTC
Journal: J Clin Endocrinol Metab | Authors: Genpeng Li | Species: human | Application: WB - Rapid evaluation of hepatocellular carcinoma by detecting plasma exosomes with time-resolved fluorescence immunochromatographic test strips
Journal: Mikrochim Acta | Authors: Jiaming Li | Species: human | Application: WB - Delivering miR-23b-3p by small extracellular vesicles to promote cell senescence and aberrant lipid metabolism
Journal: BMC Biol | Authors: Ye Jin | Application: WB - Extracellular Vesicles Carry lncRNA SNHG16 to Promote Metastasis of Breast Cancer Cells via the miR-892b/PPAPDC1A Axis.
Journal: Front Cell Dev Biol | Authors: Wenfei Xia | Species: human | Application: WB - Exosomal miR-199a-3p derived from follicular fluid modulates the immune microenvironment in polycystic ovary syndrome by regulating macrophage polarization.
Journal: J Ovarian Res | Authors: Xina Zhen | Species: human | Application: WB - Dental Pulp Stem Cell-Derived Intracellular Vesicles Promote Cartilage Regeneration and Alleviate Pain in Temporomandibular Joint Osteoarthritis.
Journal: Int Dent J | Authors: Chenxuan Shu | Species: human | Application: WB - Exosomal transfer of miR-375-3p from pancreatic β cells to hepatocytes impairs hepatic glycogenesis via Rbpj repression.
Journal: World J Diabetes | Authors: Fang-Zhi Xu | Application: WB - Evaluation of circulating small extracellular vesicle-derived miRNAs as diagnostic biomarkers for differentiating between different pathological types of early lung cancer
Journal: Sci Rep | Authors: Yi-fang Jiang | Species: human | Application: WB - Plasma extracellular vesicle microRNA profiling and the identification of a diagnostic signature for stage I lung adenocarcinoma
Journal: Cancer Sci | Authors: Shugeng Gao | Species: human | Application: WB - Nicotine self-administration with menthol and audiovisual cue facilitates differential packaging of CYP2A6 and cytokines/chemokines in rat plasma extracellular vesicles.
Journal: Sci Rep | Authors: Asit Kumar | Application: WB - Plasma extracellular vesicle microRNA profiling and the identification of a diagnostic signature for stage I lung adenocarcinoma
Journal: Cancer Sci | Authors: Shugeng Gao | Species: human | Application: WB - Differential proteomic analysis of plasma-derived exosomes as diagnostic biomarkers for chronic HBV-related liver disease
Journal: Sci Rep | Authors: Bo Ye | Species: human | Application: WB - Tumor-Derived Exosomal piR-hsa-28212 Promotes Lymphatic Metastasis in Breast Cancer.
Journal: Cancer Sci | Authors: Yafen Wang | Species: human | Application: WB - αvβ3-targeted sEVs for efficient intracellular delivery of proteins using MFG-E8.
Journal: BMC Biotechnol | Authors: Junxin Mai | Species: human | Application: WB - Molecular Profiling of A549 Cell-Derived Exosomes: Proteomic, miRNA, and Interactome Analysis for Identifying Potential Key Regulators in Lung Cancer
Journal: Cancers (Basel) | Authors: Alexandros Giannopoulos-Dimitriou | Species: human | Application: WB - Molecular Profiling of A549 Cell-Derived Exosomes: Proteomic, miRNA, and Interactome Analysis for Identifying Potential Key Regulators in Lung Cancer
Journal: Cancers (Basel) | Authors: Alexandros Giannopoulos-Dimitriou | Species: human | Application: WB - LincRNA01703 Facilitates CD81+ Exosome Secretion to Inhibit Lung Adenocarcinoma Metastasis via the Rab27a/SYTL1/CD81 Complex
Journal: Cancers (Basel) | Authors: Yun Huang | Species: human | Application: WB - Identification of stable reference genes for relative quantification of long RNA expression in urinary extracellular vesicles
Journal: J Extracell Biol | Authors: Xiao-Xiao Zhu | Species: human | Application: WB - Exo70 Promotes the Invasion of Pancreatic Cancer Cells via the Regulation of Exosomes
Journal: Cancers (Basel) | Authors: Jingzhou Xiang | Species: human | Application: WB - Reticulocalbin 1 is required for proliferation and migration of non-small cell lung cancer cells regulated by osteoblast-conditioned medium
Journal: J Cell Mol Med | Authors: Haijing Fu | Species: human | Application: WB - Enhanced therapeutic effects of mesenchymal stem cell-derived extracellular vesicles within chitosan hydrogel in the treatment of diabetic foot ulcers
Journal: J Mater Sci Mater Med | Authors: Shuangshuang Yang | Species: human | Application: WB,FC - Bone marrow stromal and anterior cruciate ligament remnant cell co-culture-derived extracellular vesicles promote cell activity in both cell types
Journal: J Cell Mol Med | Authors: Sung-Yen Lin | Species: rabbit | Application: WB - scRNA-Seq reveals age-dependent microglial evolution as a determinant of immune response following spinal cord injury
Journal: Brain Res Bull | Authors: Lufei Shao | Application: IF - Enhancement of Osteoblast Function through Extracellular Vesicles Derived from Adipose-Derived Stem Cells
Journal: Biomedicines | Authors: Mei-Ling Ho | Species: human | Application: WB - Syndecan-1-mediated loading of VEGF-A into small extracellular vesicles facilitates peritubular capillary repair during AKI-to-CKD transition.
Journal: iScience | Authors: Xin Zhong - Extracellular vesicle derived miRNAs from plasma as promising diagnosis and prognosis biomarkers for neuroblastoma.
Journal: iScience | Authors: Duo Zhou | Species: human | Application: WB - CD9 exacerbates pathological cardiac hypertrophy through regulating GP130/STAT3 signaling pathway
Journal: iScience | Authors: Yue Li | Application: WB,IF - Syndecan-1-mediated loading of VEGF-A into small extracellular vesicles facilitates peritubular capillary repair during AKI-to-CKD transition.
Journal: iScience | Authors: Xin Zhong - microRNAs profiling of small extracellular vesicles from midbrain tissue of Parkinson's disease
Journal: Front Mol Neurosci | Authors: Zhengzhe Li | Application: WB - Mesenchymal stem cells-derived exosomes ameliorate high glucose and lipopolysaccharide-induced HPMECs injury through the Nrf2/HO-1 pathway
Journal: Autoimmunity | Authors: Hongyan Sun | Species: human | Application: WB - Circulating exosomal circRNA-miRNA-mRNA network in a familial partial lipodystrophy type 3 family with a novel PPARG frameshift mutation c.418dup
Journal: Am J Physiol Endocrinol Metab | Authors: Liyuan Zhou | Species: human - Comprehensive analysis of tissue-derived small extracellular vesicles transcriptomic and extensively targeted lipidomics from patients with high-grade serous ovarian cancer.
Journal: BMC Cancer | Authors: Mengdi Fu | Species: human | Application: WB - miRNA profiling of granulosa cell-derived exosomes reveals their role in promoting follicle development
Journal: J Cell Physiol | Authors: Qilin Zhou | Species: human | Application: WB - Lung cancer cell-derived exosomal EHF drives M2 macrophage polarization via transcriptional activation of RNF41 to promote tumor progression.
Journal: Regen Ther | Authors: Zhongjie Chen | Species: human | Application: WB - Exosomes derived from autologous dermal fibroblasts promote diabetic cutaneous wound healing through the Akt/β-catenin pathway.
Journal: Cell Cycle | Authors: Xinye Han | Application: WB - HIV-HPV interactions via extracellular vesicles among tobacco smokers and nonsmokers.
Journal: Exp Biol Med (Maywood) | Authors: Namita Sinha | Species: human | Application: WB - Effect of lyophilized exosomes derived from umbilical cord stem cells on chronic anterior cruciate ligament cell injury
Journal: J Orthop Surg Res | Authors: Hon Lok Lo | Species: human | Application: WB - Identification and evaluation of circulating exosomal miRNAs for the diagnosis of postmenopausal osteoporosis
Journal: J Orthop Surg Res | Authors: Zhibang Sun | Species: human | Application: WB - STAT3 Inhibitor Increases α-Synuclein in PFF-Treated Astroglia Cells by Dysregulating Autophagy and Potentially Affects Exosome Biogenesis
Journal: Neuromolecular Med | Authors: Yangfu Luo | Species: human | Application: WB - STAT3 Inhibitor Increases α-Synuclein in PFF-Treated Astroglia Cells by Dysregulating Autophagy and Potentially Affects Exosome Biogenesis
Journal: Neuromolecular Med | Authors: Yangfu Luo | Species: human | Application: WB - Extracellular vesicles secreted by adipose-derived stem cells alleviate dedifferentiation and senescence in monolayer-expanded chondrocytes by suppressing interleukin-1β-induced MAPK signaling.
Journal: Cell Transplant | Authors: Shun-Cheng Wu | Species: human | Application: WB - Exosome miRNAs profiling in serum and prognostic evaluation in patients with multiple myeloma
Journal: Blood Sci | Authors: Teng Fang | Species: human | Application: WB - Small Extracellular Vesicles Derived from NF2-Associated Schwannoma Cells Modulate Tumor Progression and Immunity via HSP90.
Journal: Curr Oncol | Authors: Ying Wang | Species: human | Application: WB - Glioma Cell-Derived Apoptotic Extracellular Vesicles Promote Tumorigenesis and Temozolomide Resistance by Delivering LncRNA-XIST.
Journal: J Biochem Mol Toxicol | Authors: Peng Du | Species: human | Application: WB - Plasma Exosome miR-203a-3p is a Potential Liquid Biopsy Marker for Assessing Tumor Progression in Breast Cancer Patients
Journal: Breast Cancer (Dove Med Press) | Authors: Xin Yang | Species: human | Application: WB - Plasma Exosome miR-203a-3p is a Potential Liquid Biopsy Marker for Assessing Tumor Progression in Breast Cancer Patients
Journal: Breast Cancer (Dove Med Press) | Authors: Xin Yang | Species: human | Application: WB - Human umbilical cord mesenchymal stem cells improve disease characterization of Sjogren's syndrome in NOD mice through regulation of gut microbiota and Treg/Th17 cellular immunity
Journal: Immun Inflamm Dis | Authors: Yao Zou | Species: human | Application: WB - Integrative analysis of miRNA in cartilage-derived extracellular vesicles and single-cell RNA-seq profiles in knee osteoarthritis
Journal: Arch Biochem Biophys | Authors: Yujie Ning | Species: human | Application: WB - Phosphatidylserine-Exposing Annexin A1-Positive Extracellular Vesicles: Potential Cancer Biomarkers
Journal: Vaccines (Basel) | Authors: Gloria I Perez | Species: human | Application: WB - Exosomes derived from thymic stromal lymphopoietin-treated dendritic cells regulate T helper 17/regulatory T cell differentiation via miR-21/Smad7 axis.
Journal: Exp Cell Res | Authors: Qingshan Ji | Species: human | Application: WB - Normal kidney tissue derived extracellular vesicles suppress clear cell renal cell carcinoma progression via transfer their inhibitory miRNAs.
Journal: Cancer Treat Res Commun | Authors: Liqun Huang | Species: human | Application: WB - Identification and prognostic prediction of high-risk multiple myeloma by exosomal microRNA.
Journal: Front Oncol | Authors: Ying Tian | Species: human | Application: WB - Plasma extracellular vesicle long RNA profiling identifies a diagnostic signature for stage I lung adenocarcinoma.
Journal: Transl Lung Cancer Res | Authors: Wei Guo | Species: human | Application: WB - Designer Exosomes for Targeted Delivery of a Novel Therapeutic Cargo to Enhance Sorafenib-Mediated Ferroptosis in Hepatocellular Carcinoma
Journal: Front Oncol | Authors: Xiaoju Li | Species: human | Application: WB - Neural stem cell-derived small extracellular vesicles ameliorate disease progression in the SOD1 G93A murine model of amyotrophic lateral sclerosis.
Journal: J Neuropathol Exp Neurol | Authors: Yalan Wan - Evaluation of plasma exosomal miRNAs as potential diagnostic biomarkers of lymph node metastasis in papillary thyroid carcinoma
Journal: Endocrine | Authors: Wenjie Chen | Species: human | Application: WB - Possible New Histological Prognostic Index for Large B-Cell Lymphoma
Journal: J Clin Med | Authors: Hideaki Nitta | Species: human | Application: IHC - Exploratory profiling of serum small extracellular vesicle-associated miRNAs as candidate biomarkers for Moyamoya disease.
Journal: Biochem Biophys Rep | Authors: Lin Yan - Possible New Histological Prognostic Index for Large B-Cell Lymphoma
Journal: J Clin Med | Authors: Hideaki Nitta | Species: human | Application: IHC - The role of plasma exosomal lnc-SNAPC5-3:4 in monitoring the efficacy of anlotinib in the treatment of advanced non-small cell lung cancer.
Journal: J Cancer Res Clin Oncol | Authors: Chun Liu | Species: human | Application: WB - A New Histology-Based Prognostic Index for Aggressive T-Cell lymphoma: Preliminary Results of the "TCL Urayasu Classification"
Journal: J Clin Med | Authors: Hideaki Nitta | Species: human | Application: IHC - A New Histology-Based Prognostic Index for Acute Lymphoblastic Leukemia: Preliminary Results of the "ALL Urayasu Classification".
Journal: J Clin Med | Authors: Toru Mitsumori | Species: human | Application: IHC - PCOS combined with obesity aggravates the metabolic and immune abnormality in females.
Journal: BMC Womens Health | Authors: Mei-Ling Chen | Species: human | Application: WB - Whole-transcriptome sequencing reveals hypoxic esophageal squamous cell carcinoma-derived migrasomes driving cancer-associated fibroblast activation.
Journal: Brief Funct Genomics | Authors: Guan'en Qiao | Species: human | Application: WB - Exosomal miR-626 promotes the malignant behavior of oral cancer cells by targeting NFIB.
Journal: Mol Biol Rep | Authors: Chao Lou | Species: human | Application: WB - Exosomal miR-222-3p derived from dermal papilla cells inhibits melanogenesis in melanocytes by targeting SOX10 in rabbits
Journal: Anim Biosci | Authors: Yang Chen | Species: rabbit | Application: WB - Exosome-derived Uc.339 as a potential biomarker for bone metastasis from pulmonary adenocarcinoma
Journal: Tissue Cell | Authors: Weiqiang Lai | Species: human | Application: WB - Dental pulp stem cell-derived exosomes promote axonal repair in spinal cord injury by suppressing neuroinflammation and apoptosis.
Journal: Tissue Cell | Authors: Feng Li | Species: human | Application: WB - Exosomes from adipose-derived stem cells overexpressing microRNA-671-3p promote fat graft angiogenesis and adipogenic differentiation
Journal: Tissue Cell | Authors: Xiaoyan Hao | Species: human | Application: WB - Dental pulp stem cell-derived exosomes promote axonal repair in spinal cord injury by suppressing neuroinflammation and apoptosis.
Journal: Tissue Cell | Authors: Feng Li | Species: human | Application: WB - Research on the Role of Exosomes Secreted by Immortalized Adipose-Derived Mesenchymal Stem Cells Differentiated into Pericytes in the Repair of High Glucose-Induced Retinal Vascular Endothelial Cell Damage
Journal: Exp Eye Res | Authors: Sihui Wu | Species: human | Application: WB - Adipose-Derived Stem Cell Exosomes Inhibit Hypertrophic Scaring Formation by Regulating Th17/Treg Cell Balance
Journal: Biomed Res Int | Authors: Hongtao Wang | Species: human | Application: WB - Downregulation of the CD151 protects the cardiac function by the crosstalk between the endothelial cells and cardiomyocytes via exosomes
Journal: PLoS One | Authors: Luying Jiang | Species: human | Application: WB - Differential packaging of inflammatory cytokines/ chemokines and oxidative stress modulators in U937 and U1 macrophages-derived extracellular vesicles upon exposure to tobacco constituents.
Journal: PLoS One | Authors: Sanjana Haque | Species: human | Application: WB - Pancreatic cancer-derived exosomal miR-510 promotes macrophage M2 polarization and facilitates cancer cell aggressive phenotypes
Journal: Hum Cell | Authors: Tao Wang | Species: human | Application: WB - MicroRNA-488-3p-loaded engineered exosomes inhibit proliferation, migration and invasion of hepatocellular carcinoma by targeting SEC61G.
Journal: PLoS One | Authors: Huijie Gao | Species: human | Application: WB - Downregulation of the CD151 protects the cardiac function by the crosstalk between the endothelial cells and cardiomyocytes via exosomes
Journal: PLoS One | Authors: Luying Jiang | Species: human | Application: WB - A cryostat-based frozen section method to increase the yield of extracellular vesicles extracted from different tissues
Journal: Biotechniques | Authors: Shuangzhu Yang | Application: WB - Construction and analysis of expression profile of exosomal lncRNAs in pleural effusion in lung adenocarcinoma
Journal: J Clin Lab Anal | Authors: Xiaolu Huang | Species: human | Application: WB - Cutaneous squamous cell carcinoma-derived exosomal MicroRNA-31 acts as an oncogene by targeting the tumor suppressor RhoBTB1
Journal: Arch Dermatol Res | Authors: Yanan Mu | Species: human | Application: WB - Cerebrospinal fluid exosomal microRNAs as biomarkers for diagnosing or monitoring the progression of non-small cell lung cancer with leptomeningeal metastases
Journal: Biotechnol Genet Eng Rev | Authors: Huiying Li | Species: human | Application: WB - GSTP1-modified exosomes derived from ADMSCs relieve LPS-induced acute lung injury.
Journal: Cytotechnology | Authors: Hong Guan | Species: human | Application: WB - CircNCOA4 knockdown attenuates OGD-induced neuron injury through miR-338-5p/PDE4B axis
Journal: Exp Brain Res | Authors: Danyang Wang | Species: human | Application: WB - Astragaloside IV - mediated endothelial progenitor cell exosomes promote autophagy and inhibit apoptosis in hyperglycemic damaged endothelial cells via miR-21/PTEN axis
Journal: Folia Histochem Cytobiol | Authors: Wu Xiong | Species: human | Application: WB - Immunojanus Particles for low-volume and isolation-free unlabeled characterization of small Extracellular Vesicle in biofluids: Characterization of disease type by surface marker profiling
Journal: bioRxiv | Authors: Sonu Kumar | Application: IF - Circulating small extracellular vesicle RNA profiling for the detection of T1a stage colorectal cancer and precancerous advanced adenoma
Journal: Elife | Authors: Li Min | Species: human | Application: WB - Harnessing Extracellular Vesicles for Stabilized and Functional IL-10 Delivery in Macrophage Immunomodulation
Journal: bioRxiv | Authors: Najla A Saleh | Species: human | Application: WB,IF - Harnessing extracellular vesicles for stabilized and functional IL-10 delivery in macrophage immunomodulation.
Journal: Extracell Vesicle | Authors: Najla A. Saleh - Exosomal LINC00323 accelerates angiogenesis through activating the MAPK and JAK-STAT pathways by stabilizing CDC5L in NSCLC.
Journal: Cell Oncol (Dordr) | Authors: Bin Ke | Species: human | Application: WB - Exosomes target liver TREM-1 to break the systemic inflammatory cascade and improve spinal cord injury outcomes.
Journal: J Orthop Translat | Authors: Chengfang Luo | Species: human | Application: WB - Astrocytic PDE7B Drives Blood-Brain Barrier Breakdown via Extracellular Vesicles in Demyelinating Disease.
Journal: Glia | Authors: Jing Duan - Engineering Piezo1-Mediated Calcium Signalling for Enhanced Extracellular Vesicle Biogenesis and Cargo Loading.
Journal: J Extracell Biol | Authors: Najla A. Saleh | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
