CHAT Polyclonal antibody 24418-1-AP proteintech
$149.00
In stock
SKU
24418-1-AP
| Catalog Number | 24418-1-AP |
| Synonyms | EC:2.3.1.6, Choline O-acetyltransferase, choline acetyltransferase, Choline acetylase, CHOACTase |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | rat brain tissue, human placenta tissue, mouse brain tissue |
| Tested Applications — Positive IP detected in | rat brain tissue |
| Tested Applications — Positive IHC detected in | rat brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | rat brain tissue, human placenta tissue, mouse brain tissue |
| Positive IP detected in | rat brain tissue |
| Positive IHC detected in | rat brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag19550 Product name: Recombinant human CHAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-630 aa of BC130617 Sequence: SDTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMTQSSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP Predict reactive species |
| Full Name | choline acetyltransferase |
| Calculated Molecular Weight | 748 aa, 83 kDa |
| Observed Molecular Weight | 60-66 kDa, 45 kDa |
| GenBank Accession Number | BC130617 |
| Gene Symbol | CHAT |
| Gene ID (NCBI) | 1103 |
| RRID | AB_2879536 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P28329 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CHAT antibody 24418-1-AP | Download protocol |
| IHC protocol for CHAT antibody 24418-1-AP | Download protocol |
| IP protocol for CHAT antibody 24418-1-AP | Download protocol |
| WB protocol for CHAT antibody 24418-1-AP | Download protocol |
| mouse | IF Int Immunopharmacol New strategy to treat spinal cord injury: Nafamostat mesilate suppressed NLRP3-mediated pyroptosis during acute phase Authors - Yongfu Lou View Article |
| Citations | 6 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
CHAT (choline acetyltransferase) belongs to the carnitine/choline acetyltransferase family. It catalyzes the reversible synthesis of acetylcholine (ACh) from acetyl CoA and choline at cholinergic synapses. Defects in CHAT are the cause of congenital myasthenic syndrome with episodic apnea (CMSEA). CHAT is known to to be present exclusively in the cytoplasm of cholinergic neurons and anti-CHAT antibody has been considered as the best marker for cholinergic neurons. It has been observed that CHAT gene generates multiple mRNA splice variants, including peripheral type CHAT (pCHAT) and common type CHAT (cCHAT), encoding 40-55 kDa and 66-70 kDa forms of proteins, respectively. Protocols Product Specific Protocols IF protocol for CHAT antibody 24418-1-AP Download protocol IHC protocol for CHAT antibody 24418-1-AP Download protocol IP protocol for CHAT antibody 24418-1-AP Download protocol WB protocol for CHAT antibody 24418-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Aerobic glycolysis is the predominant means of glucose metabolism in neuronal somata, which protects against oxidative damage
Journal: Nat Neurosci | Authors: Yao Wei | Species: mouse | Application: IF - Expression of the ACE2 virus entry protein in the nervus terminalis reveals the potential for an alternative route to brain infection in COVID-19.
Journal: bioRxiv | Authors: Katarzyna Bilinska | Species: mouse | Application: IF - NRF2 activation suppresses motor neuron ferroptosis induced by the SOD1G93A mutation and exerts neuroprotection in amyotrophic lateral sclerosis
Journal: Neurobiol Dis | Authors: Biying Yang | Species: mouse | Application: IF - Disrupted Motor Neuron and Neuromuscular Junction Development in an Albino Mice Model of Infantile Nystagmus
Journal: Invest Ophthalmol Vis Sci | Authors: Sampath Vemula | Species: mouse | Application: IF - New strategy to treat spinal cord injury: Nafamostat mesilate suppressed NLRP3-mediated pyroptosis during acute phase
Journal: Int Immunopharmacol | Authors: Yongfu Lou | Species: mouse | Application: IF - Nociceptor neurons promote PDAC progression and cancer pain by interaction with cancer-associated fibroblasts and suppression of natural killer cells
Journal: Cell Res | Authors: Kaiyuan Wang | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
