Collagen Type X Polyclonal antibody 26984-1-AP proteintech
$149.00
In stock
SKU
26984-1-AP
| Catalog Number | 26984-1-AP |
| Synonyms | COL10, COL10A1, Col10a 1, Collagen alpha-1(X) chain, Collagen type X alpha 1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, rabbit |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | BxPC-3 cells, ROS1728 cells, HCT 116 cells |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | BxPC-3 cells, ROS1728 cells, HCT 116 cells |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25741 Product name: Recombinant human COL10A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 518-585 aa of BC130621 Sequence: QAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPR Predict reactive species |
| Full Name | collagen, type X, alpha 1 |
| Calculated Molecular Weight | 680 aa, 66 kDa |
| Observed Molecular Weight | 60-66 kDa |
| GenBank Accession Number | BC130621 |
| Gene Symbol | COL10A1 |
| Gene ID (NCBI) | 1300 |
| RRID | AB_3085918 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03692 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Collagen Type X antibody 26984-1-AP | Download protocol |
| WB protocol for Collagen Type X antibody 26984-1-AP | Download protocol |
| human | WB J Orthop Surg Res Gentiopicroside ameliorates the lipopolysaccharide-induced inflammatory response and hypertrophy in chondrocytes Authors - Longfei Li View Article |
| mouse | IHC Small Sci Chondrocyte-Targeted Nanoparticles Loaded with N-Acetylcysteine Protect Articular Cartilage and Attenuate Osteoarthritis by Inhibiting Ferroptosis via Glutathione Maintenance. Authors - Shaoyi Wang View Article |
| rabbit | WB Mater Today Bio Kartogenin-loaded chitosan composite scaffold with cartilage-mimetic microstructure for layered osteochondral repair and cartilage phenotype maintenance. Authors - Hengyu Liu View Article |
| Audrey (Verified Customer) (07-02-2026) | works well Applications: Immunofluorescence Primary Antibody Dilution: 1/200 |
| Citations | 24 |
| Dilutions | WB : 1:500-1:1000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Collagen type X alpha 1 (COL10A1), a secreted, short-chain collagen, belongs to the collagen family, which is a major interstitial matrix component specifically expressed by hypertrophic chondrocytes. COL10A1 expression is elevated in many solid tumor types, such as colon cancer, esophagus cancer, and breast cancer, and displays vital roles in many critical cellular processes (PMID: 30154451, 25321476). Protocols Product Specific Protocols IF protocol for Collagen Type X antibody 26984-1-AP Download protocol WB protocol for Collagen Type X antibody 26984-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The p.W651fsX666 mutation on COL10A1 results in impaired trimerization of normal collagen X to induce Schmid type Metaphyseal chondrodysplasia
Journal: Hum Mol Genet | Authors: Jingye Yang | Species: human | Application: WB - PIEZO1-GPX4 Axis Mediates Mechanical Stress-Induced Vertebral Growth Plate Dysplasia via Ferroptosis Activation
Journal: Adv Sci (Weinh) | Authors: Fei Chen | Species: mouse | Application: WB,IHC,IF - Gentiopicroside ameliorates the lipopolysaccharide-induced inflammatory response and hypertrophy in chondrocytes
Journal: J Orthop Surg Res | Authors: Longfei Li | Species: human | Application: WB - Chondrocyte-Targeted Nanoparticles Loaded with N-Acetylcysteine Protect Articular Cartilage and Attenuate Osteoarthritis by Inhibiting Ferroptosis via Glutathione Maintenance.
Journal: Small Sci | Authors: Shaoyi Wang | Species: mouse | Application: IHC - Kartogenin-loaded chitosan composite scaffold with cartilage-mimetic microstructure for layered osteochondral repair and cartilage phenotype maintenance.
Journal: Mater Today Bio | Authors: Hengyu Liu | Species: rabbit | Application: WB - Bioinspired scaffold recapitulating chondrogenic ontogeny and microenvironment for functional cartilage regeneration.
Journal: Bioact Mater | Authors: Tianyu Yu | Application: WB - Kartogenin-loaded chitosan composite scaffold with cartilage-mimetic microstructure for layered osteochondral repair and cartilage phenotype maintenance.
Journal: Mater Today Bio | Authors: Hengyu Liu | Species: rabbit | Application: WB - Cancer-associated fibroblasts promote EGFR-TKI resistance via the CTHRC1/glycolysis/H3K18la positive feedback loop
Journal: Oncogene | Authors: Chen Zhang | Species: human | Application: IF - Gene-activated porous scaffolds integrating SOX9 mRNA lipid nanoparticles enable uniformly distributed ectopic chondrogenesis in subcutaneous model.
Journal: Int J Biol Macromol | Authors: Shynie Tan - WDR63 enhances the chondrogenic differentiation and regenerative potential of stem cell from apical papilla by facilitating vimentin function to promote mitochondrial fission.
Journal: Stem Cell Res Ther | Authors: Jiawei Zhou | Species: human | Application: IF - Identification and validation of biomarkers in gastric cancer-associated membranous nephropathy: Insights from comprehensive bioinformatics analysis and machine learning.
Journal: Front Immunol | Authors: Qianqian Xu | Species: human | Application: IHC - Single-cell RNA-seq reveals a repair pattern in cystic lesions in steroid induced osteonecrosis of the femoral head
Journal: Front Immunol | Authors: Peng Peng - Single-cell RNA-seq reveals a repair pattern in cystic lesions in steroid induced osteonecrosis of the femoral head
Journal: Front Immunol | Authors: Peng Peng - DDRGK1 preserves intervertebral disc development through ufmylation.
Journal: Cell Mol Life Sci | Authors: Mingkuan Lu | Species: mouse | Application: IHC - Genotype and phenotype correlation analysis in 27 families with multiple osteochondroma and validation by ATDC5 chondrocyte models.
Journal: Bone Joint Res | Authors: Xiaoyan Guo | Species: mouse | Application: WB - Calcified Cartilage Zone Remodeling Induced by IL-1β Derived from Necrotic Subchondral Bone Initiates Cartilage Degeneration in Patients with Glucocorticoids-induced Osteonecrosis of the Femoral Head
Journal: Inflammation | Authors: Pengbo Wang | Species: mouse | Application: WB - High fluid shear stress induces Hippo/YAP pathway in articular cartilage superficial layer cells: A potential mechanistic link to osteoarthritis
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Haitao Li | Species: rat | Application: WB - PIEZO1-Primary Cilia Axis Mediates Compressive Stress-Induced Growth Plate Degeneration and Ossification in Adolescent Idiopathic Scoliosis.
Journal: JOR Spine | Authors: Fei Chen | Species: mouse | Application: IF - Gentiopicroside ameliorates the lipopolysaccharide-induced inflammatory response and hypertrophy in chondrocytes
Journal: J Orthop Surg Res | Authors: Longfei Li | Species: human | Application: WB - Mineral Content and Extracellular Matrix Protein Expression in Mouse Growth Plates During Epiphyseal Fusion: An Observational Study
Journal: Calcif Tissue Int | Authors: Xinhang Yu | Species: mouse | Application: IHC - Exercise therapy-associated changes in Periostin (POSTN) osteoarthritis are linked to Hippo-YAP signaling.
Journal: Mol Biol Rep | Authors: Dandan Hao - The p.W651fsX666 mutation on COL10A1 results in impaired trimerization of normal collagen X to induce Schmid type Metaphyseal chondrodysplasia
Journal: Hum Mol Genet | Authors: Jingye Yang | Species: human | Application: WB - Optimal Timing for Initiating Postoperative Mobilization for Healing Enthesis in Onto-Surface Repair
Journal: J Orthop Res | Authors: Takuma Naka | Species: rat | Application: IHC - Growth hormone therapy promotes bone growth in idiopathic short stature children by activating the IGF-1 pathway via IGFBP2-mediated inhibition of THBS1.
Journal: In Vitro Cell Dev Biol Anim | Authors: Haiyan Liu | Species: human | Application: WB - A truncated COL10A1 protein causes Schmid metaphyseal chondrodysplasia via protein downregulation and impairing α1 trimer formation and secretion.
Journal: Funct Integr Genomics | Authors: Zhe Sun - Hydroxysafflor yellow A attenuates TBHP-induced lipid peroxidation and calcification-related changes in human endplate chondrocytes: involvement of SLC7A11/GPX4 signaling.
Journal: Cytotechnology | Authors: Zongyu Zhang - Bioprinting of Biomimetic Periosteum-Bone Integrated Scaffolds.
Journal: Adv Mater | Authors: Lin Du
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
