CRIP2 Polyclonal antibody 14801-1-AP proteintech
$149.00
In stock
SKU
14801-1-AP
| Catalog Number | 14801-1-AP |
| Synonyms | CRIP, CRIP 2, CRP 2, CRP2, CRP-2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, zebrafish |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, IP, ELISA |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, mouse heart tissue, MCF-7 cells, mouse brain tissue |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HeLa cells, mouse heart tissue, MCF-7 cells, mouse brain tissue |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag6515 Product name: Recombinant human CRIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC000434 Sequence: MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP Predict reactive species |
| Full Name | cysteine-rich protein 2 |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 23-29 kDa |
| GenBank Accession Number | BC000434 |
| Gene Symbol | CRIP2 |
| Gene ID (NCBI) | 1397 |
| RRID | AB_2245316 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52943 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CRIP2 antibody 14801-1-AP | Download protocol |
| WB protocol for CRIP2 antibody 14801-1-AP | Download protocol |
| rat | WB,IP,IF Basic Res Cardiol Alkaline nucleoplasm facilitates contractile gene expression in the mammalian heart. Authors - Alzbeta Hulikova View Article |
| zebrafish,human | WB,IF Cell Mol Life Sci Crip2 affects vascular development by fine-tuning endothelial cell aggregation and proliferation Authors - Shuaiqi Yang KD Validated View Article |
| human | WB Mol Cell Targeted citrullination enables p53 binding to non-canonical sites. Authors - Alexandra Indeglia View Article |
| mouse | WB,IF bioRxiv The copper chaperone ATOX1 exhibits differential protein-protein interactions and contributes to skeletal myoblast differentiation. Authors - Nathan Ferguson View Article |
| Joleen (Verified Customer) (06-07-2019) | The CRIP2 antibody works well and the protein shows up prominently as the lower band. Applications: Western Blot, Primary Antibody Dilution: 1:1k Cell Tissue Type: MDCK GII CRIP2 Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:14801-1-AP) |
| Citations | 6 |
| Dilutions | WB : 1:1000-1:8000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
CRIP2, also known as CRP2 and ESP1, belongs to the cysteine-rich intestinal protein family (CRIP family). The CRIP family is a subfamily of the highly conserved Lin-1, Isl1, Mec3/double zinc finger protein family that exhibits diverse biological functions. CRIP2 is a cardiac vascular marker, and its expression is detected in cardiac endothelial cells during development and in the adult heart(PMID: 40118853). Protocols Product Specific Protocols IF protocol for CRIP2 antibody 14801-1-AP Download protocol WB protocol for CRIP2 antibody 14801-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Alkaline nucleoplasm facilitates contractile gene expression in the mammalian heart.
Journal: Basic Res Cardiol | Authors: Alzbeta Hulikova | Species: rat | Application: WB,IP,IF - Crip2 affects vascular development by fine-tuning endothelial cell aggregation and proliferation
Journal: Cell Mol Life Sci | Authors: Shuaiqi Yang KD Validated | Species: zebrafish,human | Application: WB,IF - The impact and mechanisms of CRIP2 on the biological behavior of triple-negative breast cancer cells.
Journal: Transl Breast Cancer Res | Authors: Zhihua Tan | Species: human | Application: WB - The copper chaperone ATOX1 exhibits differential protein-protein interactions and contributes to skeletal myoblast differentiation.
Journal: bioRxiv | Authors: Nathan Ferguson | Species: mouse | Application: WB,IF - Effect of miR-6767-5p on breast cancer cell phenotype and its regulatory mechanism.
Journal: Sci Rep | Authors: Zhi-hua Tan | Species: human | Application: WB - Targeted citrullination enables p53 binding to non-canonical sites.
Journal: Mol Cell | Authors: Alexandra Indeglia | Species: human | Application: WB - The Copper Chaperone ATOX1 Exhibits Differential Protein-Protein Interactions and Contributes to Skeletal Myoblast Differentiation.
Journal: Mol Cell Biol | Authors: Nathan Ferguson
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
