SLPI Recombinant monoclonal antibody, PBS Only 83965-4-PBS proteintech
$699.00
In stock
SKU
83965-4-PBS
| Catalog Number | 83965-4-PBS |
| Synonyms | 241057F8, ALK1, ALP, Antileukoprotease, Antileukoproteinase |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag1673 Product name: Recombinant human SLPI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC020708 Sequence: MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA Predict reactive species |
| Full Name | secretory leukocyte peptidase inhibitor |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC020708 |
| Gene Symbol | SLPI |
| Gene ID (NCBI) | 6590 |
| RRID | AB_3671543 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | P03973 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241057F8 |
| Conjugation | Unconjugated |
SLPI, a member of Whey acidic protein family, could mediate a variety of biological processes including cell proliferation and apoptosis, repairing reaction and immune response, with crucial roles in anti-protease, anti-inflammatory, anti-bacterial and anti-virus. SLPI is mainly expressed in epithelial cells.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
