CXCL10/IP-10 Recombinant monoclonal antibody 85307-1-RR proteintech
$149.00
In stock
SKU
85307-1-RR
| Catalog Number | 85307-1-RR |
| Synonyms | CXCL10, CXCL10/IP10, IP10, 10 kDa interferon gamma-induced protein, C X C motif chemokine 10 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | IFN gamma, LPS and Brefeldin A treated THP-1 cells |
| Tested Applications — Positive IF/ICC detected in | IFN gamma, LPS and Brefeldin A treated THP-1 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Positive WB detected in | IFN gamma, LPS and Brefeldin A treated THP-1 cells |
| Positive IF/ICC detected in | IFN gamma, LPS and Brefeldin A treated THP-1 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2489 Product name: Recombinant Human CXCL10/IP-10 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-98 aa of BC010954 Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 10 |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC010954 |
| Gene Symbol | CXCL10 |
| Gene ID (NCBI) | 3627 |
| RRID | AB_3744130 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P02778 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CXCL10/IP-10 antibody 85307-1-RR | Download protocol |
| WB protocol for CXCL10/IP-10 antibody 85307-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:2000 IF/ICC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242013E11 |
| Conjugation | Unconjugated |
CXCL10 (also known as IP-10) is a member of the CXC chemokine family which binds to the CXCR3 receptor to exert its biological effects. CXCL10 is a 12-kDa protein and constitutes two internal disulfide cross bridges. The predicted signal peptidase cleavage generates a 10-kDa secreted polypeptide with four conserved cysteine residues in the N-terminal. The CXCL10 gene localizes on chromosome 4 at band q21, a locus associated with an acute monocytic/B-lymphocyte lineage leukemia exhibiting translocation of t (4; 11) (q21; q23). CXCL10 mediates leukocyte trafficking, adaptive immunity, inflammation, haematopoiesis and angiogenesis. Under proinflammatory conditions CXCL10 is secreted from a variety of cells, such as leukocytes, activated neutrophils, eosinophils, monocytes, epithelial cells, endothelial cells, stromal cells (fibroblasts) and keratinocytes in response to IFN-γ. Protocols Product Specific Protocols IF protocol for CXCL10/IP-10 antibody 85307-1-RR Download protocol WB protocol for CXCL10/IP-10 antibody 85307-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
