Mouse CXCL2 Recombinant monoclonal antibody, PBS Only (Detector) 84645-4-PBS proteintech
$699.00
In stock
SKU
84645-4-PBS
| Catalog Number | 84645-4-PBS |
| Synonyms | C-X-C motif chemokine 2, Macrophage inflammatory protein 2, MIP2, Mip-2, Scyb2 |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2239 Product name: Recombinant Mouse CXCL2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 28-100 aa of NM_009140 Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 2 |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | NM_009140 |
| Gene Symbol | Cxcl2 |
| Gene ID (NCBI) | 20310 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P10889 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242007H8 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
