Claudin 1 Recombinant monoclonal antibody, PBS Only (Capture) 87782-2-PBS proteintech
$699.00
In stock
SKU
87782-2-PBS
| Catalog Number | 87782-2-PBS |
| Synonyms | Caudin 1, CLDN1, Claudin-1, CLD1, ILVASC |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, IF/ICC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag29269 Product name: Recombinant human Claudin 1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-211 aa of BC012471 Sequence: MKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV Predict reactive species |
| Full Name | claudin 1 |
| Calculated Molecular Weight | 211 aa, 23 kDa |
| Observed Molecular Weight | 20-23 kDa |
| GenBank Accession Number | BC012471 |
| Gene Symbol | Claudin 1 |
| Gene ID (NCBI) | 9076 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O95832 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 253345A9 |
| Conjugation | Unconjugated |
Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 Claudins have been identified. They are small (20-27 kilodaltons (kDa)) proteins with similar structures. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin-1 is an integral membrane protein expressed primarily in keratinocytes and normal mammary epithelial cells. Claudin 1 forms tight junctions with other claudin proteins and plays an important role in the intestinal epithelial barrier.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
