Cytochrome c Recombinant monoclonal antibody, PBS Only 83276-4-PBS proteintech
$699.00
In stock
SKU
83276-4-PBS
| Catalog Number | 83276-4-PBS |
| Synonyms | CYC, CYCS |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag1455 Product name: Recombinant human Cytochrome c protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC009578 Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE Predict reactive species |
| Full Name | cytochrome c, somatic |
| Calculated Molecular Weight | 12 kDa |
| GenBank Accession Number | BC009578 |
| Gene Symbol | Cytochrome c |
| Gene ID (NCBI) | 54205 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P99999 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230503G3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
