DOK4 Polyclonal antibody 10481-2-AP proteintech
$149.00
In stock
SKU
10481-2-AP
| Catalog Number | 10481-2-AP |
| Synonyms | docking protein 4, DOK4, IRS 5, IRS5 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse skeletal muscle tissue, rat skeletal muscle tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Positive WB detected in | mouse skeletal muscle tissue, rat skeletal muscle tissue |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag0734 Product name: Recombinant human DOK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 227-326 aa of BC003541 Sequence: TLAIAEQHKRVLLEMEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQGDSSEAKTPSQ Predict reactive species |
| Full Name | docking protein 4 |
| Calculated Molecular Weight | 37 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC003541 |
| Gene Symbol | DOK4 |
| Gene ID (NCBI) | 55715 |
| RRID | AB_2246205 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TEW6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for DOK4 antibody 10481-2-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The INS-receptor substrate family plays important roles in cellular growth, signaling and survival. IRS5/DOK4 is a new member of this family identified, which is known as docking protein 4, or downstream of tyrosine kinase-4. DOK4 might have roles in INS and IGF-1 signaling as well. Expression of IRS5/DOK4 is regulated epigenetically via histone acetylating at its promoter. DOK4 is required at early stages in the myelination process, including the initial interaction with the axon, and is also involved in Schwann cell migration and proliferation, it also regulates GDNF-mediated neurite outgrowth during neuronal development through activation of the Rap1-ERK1/2 pathway. DOK4 may represent a novel negative regulator of T cells as other DOK family members like DOK1 and DOK2. Protocols Product Specific Protocols WB protocol for DOK4 antibody 10481-2-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
