RGN/SMP30 Polyclonal antibody 17947-1-AP proteintech
$149.00
In stock
SKU
17947-1-AP
| Catalog Number | 17947-1-AP |
| Synonyms | RC, Regucalcin, RGN, RGN/SMP30, Senescence marker protein 30, SMP 30, SMP30 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, bovine |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IP, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse liver tissue, mouse small intestine tissue, rat liver tissue |
| Tested Applications — Positive IP detected in | mouse liver tissue |
| Tested Applications — Positive IHC detected in | rat kidney tissue, human liver tissue, human kidney tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:3000-1:10000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse liver tissue, mouse small intestine tissue, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | rat kidney tissue, human liver tissue, human kidney tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:3000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag12423 Product name: Recombinant human RGN,SMP30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC073173 Sequence: MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG Predict reactive species |
| Full Name | regucalcin (senescence marker protein-30) |
| Calculated Molecular Weight | 299 aa, 33 kDa |
| Observed Molecular Weight | 33 kDa, 25 kDa |
| GenBank Accession Number | BC073173 |
| Gene Symbol | RGN/SMP30 |
| Gene ID (NCBI) | 9104 |
| RRID | AB_10644486 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15493 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for RGN/SMP30 antibody 17947-1-AP | Download protocol |
| IP protocol for RGN/SMP30 antibody 17947-1-AP | Download protocol |
| WB protocol for RGN/SMP30 antibody 17947-1-AP | Download protocol |
| human,mouse | WB Ecotoxicol Environ Saf Hexavalent chromium triggers hepatocytes premature senescence via the GATA4/NF-κB signaling pathway mediated by the DNA damage response. Authors - Yu Ma View Article |
| human | WB Ecotoxicol Environ Saf Identification and functional analysis of senescence-associated secretory phenotype of premature senescent hepatocytes induced by hexavalent chromium. Authors - Yu Ma View Article |
| bovine | WB J Endocrinol Hepatic thyroid signaling of heat-stressed late pregnant and early lactating cows. Authors - Joachim Weitzel View Article |
| mouse | WB Toxicol Lett Dioscin, a natural steroid saponin, shows remarkable protective effect against acetaminophen-induced liver damage in vitro and in vivo. Authors - Zhao Xiaoming X View Article |
| Citations | 17 |
| Dilutions | WB : 1:3000-1:10000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Regucalcin (RGN), also known as SMP30, is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. SMP30 is preferentially localized in hepatocytes and renal proximal tubular epithelial cells. It is known to be related to aging, hepatocyte proliferation and tumorigenesis. It may be useful for HCC serologic screening, especially for the patients with AFP Negative. RGN encodes two isoforms: 33 kDa and 25 kDa. Protocols Product Specific Protocols IHC protocol for RGN/SMP30 antibody 17947-1-AP Download protocol IP protocol for RGN/SMP30 antibody 17947-1-AP Download protocol WB protocol for RGN/SMP30 antibody 17947-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Senescence marker protein 30 inhibits tumor growth by reducing HDAC4 expression in non-small cell lung cancer.
Journal: Transl Lung Cancer Res | Authors: Changjian Shao | Species: human,mouse | Application: WB,IHC - Identification and functional analysis of senescence-associated secretory phenotype of premature senescent hepatocytes induced by hexavalent chromium.
Journal: Ecotoxicol Environ Saf | Authors: Yu Ma | Species: human | Application: WB - Hexavalent chromium triggers hepatocytes premature senescence via the GATA4/NF-κB signaling pathway mediated by the DNA damage response.
Journal: Ecotoxicol Environ Saf | Authors: Yu Ma | Species: human,mouse | Application: WB - Hepatic thyroid signaling of heat-stressed late pregnant and early lactating cows.
Journal: J Endocrinol | Authors: Joachim Weitzel | Species: bovine | Application: WB - Senescence marker protein 30 (SMP30) protects against high glucose-induced apoptosis, oxidative stress and inflammatory response in retinal ganglion cells by enhancing Nrf2 activation via regulation of Akt/GSK-3β pathway
Journal: Int Immunopharmacol | Authors: Le Zhang | Species: mouse | Application: WB - Dioscin, a natural steroid saponin, shows remarkable protective effect against acetaminophen-induced liver damage in vitro and in vivo.
Journal: Toxicol Lett | Authors: Zhao Xiaoming X | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
