FBXO32 Recombinant monoclonal antibody 82941-1-RR proteintech
$149.00
In stock
SKU
82941-1-RR
| Catalog Number | 82941-1-RR |
| Synonyms | 230243H7, Atrogin 1, Atrogin-1, F box only protein 32, F box protein 32 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | C2C12 cells |
| Tested Applications — Positive FC (Intra) detected in | U-251 cells |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | C2C12 cells |
| Positive FC (Intra) detected in | U-251 cells |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag29394 Product name: Recombinant human FBXO32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-120 aa of BC024030 Sequence: MWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLL Predict reactive species |
| Full Name | F-box protein 32 |
| Calculated Molecular Weight | 355 aa, 42 kDa |
| GenBank Accession Number | BC024030 |
| Gene Symbol | FBXO32 |
| Gene ID (NCBI) | 114907 |
| RRID | AB_3670684 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q969P5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for FBXO32 antibody 82941-1-RR | Download protocol |
| IHC protocol for FBXO32 antibody 82941-1-RR | Download protocol |
| Citations | - |
| Dilutions | IHC : 1:50-1:500 IF/ICC : 1:125-1:500 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230243H7 |
| Conjugation | Unconjugated |
FBXO32 (F box only protein 32), also known as Atrogin 1 or MAFbx, is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif F-box. This protein is an E3 ubiquitin ligase that is markedly up-regulated in muscle atrophy. FBXO32 is thus a potential drug target for the treatment of muscle atrophy. Some data support that FBXO32 may play an important role in tumorigenesis. Recent study reveal that FBXO32 targets the oncogenic protein c-Myc for ubiquitination and degradation through the proteasome pathway. Protocols Product Specific Protocols IF protocol for FBXO32 antibody 82941-1-RR Download protocol IHC protocol for FBXO32 antibody 82941-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
