FCER1G Recombinant monoclonal antibody 85390-2-RR proteintech
$149.00
In stock
SKU
85390-2-RR
| Catalog Number | 85390-2-RR |
| Synonyms | 242829E3, Fc epsilon RI gamma, Fc receptor gamma-chain, Fc-epsilon RI-gamma, FceRI gamma |
| Host | Rabbit |
| Reactivity | human, mouse, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | THP-1 cells, HL-60 cells, RAW 264.7 cells, pig spleen tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Positive WB detected in | THP-1 cells, HL-60 cells, RAW 264.7 cells, pig spleen tissue |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Tested Reactivity | human, mouse, pig |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag4442 Product name: Recombinant human FCER1G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC033872 Sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ Predict reactive species |
| Full Name | Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide |
| Calculated Molecular Weight | 87 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC033872 |
| Gene Symbol | FcRγ |
| Gene ID (NCBI) | 2207 |
| RRID | AB_3744189 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P30273 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for FCER1G antibody 85390-2-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242829E3 |
| Conjugation | Unconjugated |
FCER1G (Fc receptor gamma-chain, FcRgamma), also known as Fc-epsilon RI-gamma, or IgE Fc receptor subunit gamma (FceRI gamma), is a component of the high-affinity immunoglobulin E (IgE) receptor (Fc epsilon RI) which is a tetrameric complex of one alpha subunit, one beta subunit, and two disulfide-linked gamma subunits (PMID: 2146219; 2531187). Fc epsilon RI is present exclusively on mast cells and basophils, mediating allergic inflammatory signaling (PMID: 17438574). FCER1G is widely expressed and contains an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors (PMID: 19098920). Protocols Product Specific Protocols WB protocol for FCER1G antibody 85390-2-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
