| Catalog Number | 28130-1-AP |
| Synonyms | GSPT1, eRF3a, EC:3.6.5.-, G1 to S phase transition 1, Eukaryotic peptide chain release factor GTP-binding subunit ERF3A |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells, HepG2 cells, PC-3 cells, SKOV-3 cells, Hela cells |
| Tested Applications — Positive IHC detected in | human ovary cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | A549 cells, HepG2 cells, PC-3 cells, SKOV-3 cells, Hela cells |
| Positive IHC detected in | human ovary cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag27963 Product name: Recombinant human GSPT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 294-499 aa of BC009503 Sequence: FNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD Predict reactive species |
| Full Name | G1 to S phase transition 1 |
| Calculated Molecular Weight | 68 aa, 4 kDa |
| Observed Molecular Weight | 80 kDa |
| GenBank Accession Number | BC009503 |
| Gene Symbol | GSPT1 |
| Gene ID (NCBI) | 2935 |
| RRID | AB_2918149 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15170 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for eRF3a/GSPT1 antibody 28130-1-AP | Download protocol |
| IHC protocol for eRF3a/GSPT1 antibody 28130-1-AP | Download protocol |
| WB protocol for eRF3a/GSPT1 antibody 28130-1-AP | Download protocol |
| human | WB bioRxiv p300/CBP degradation is required to disable the active AR enhanceosome in prostate cancer Authors - Jie Luo View Article |
| Citations | 2 |
| Dilutions | WB : 1:1000-1:4000 IHC : 1:500-1:2000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The eukaryotic Release Factor 3 (eRF3) is a GTPase that associates with eRF1 in a complex that mediates translation termination. Eukaryotic release factor 3 (eRF3) has many functions in eukaryotic cells, such as controlling the regulation of the cell cycle at the G1 to S phase transition, and regulating protein synthesis as a GTP dependent stimulator of eRF1 in translation termination. It was also reported to play a key role as an initiator of the mRNA degradation machinery in the recycling of ribosomes in successive cycles of translation,and probably also in transcription regulation. eRF3a, also known as GSPT1, is one subunit of eRF3(PMID:15917414,12923185). It involves in translation termination in response to the termination codons UAA, UAG and UGA and stimulates the activity of ERF1. eRF3a/GSPT1 exists some isoforms with MV 69 kDa and 56 kDa. Identification of a processed form of eRF3a/GSPT1 as a BIR3-binding protein-Using a GST-BIR3 fusion protein as an affinity reagent to purify new IAP binding proteins from extracts of human cells and mouse tissues, we previously isolated 3 proteins of molecular weights 23, 38 and 80 kDa. 80 kDa band confirmed that it is a processed form of the human GSPT1/eRF3a protein, lacking the first 69 residues(PMID: 12865429). Protocols Product Specific Protocols IF protocol for eRF3a/GSPT1 antibody 28130-1-AP Download protocol IHC protocol for eRF3a/GSPT1 antibody 28130-1-AP Download protocol WB protocol for eRF3a/GSPT1 antibody 28130-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications