HOXB7 Polyclonal antibody 12613-1-AP proteintech
$149.00
In stock
SKU
12613-1-AP
| Catalog Number | 12613-1-AP |
| Synonyms | HHO.C1, Homeobox protein HHO.C1, Homeobox protein Hox-2C, Homeobox protein Hox-B7, HOX2C |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Applications | WB, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | SKOV-3 cells |
| Tested Applications — Positive IP detected in | SKOV-3 cells |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Positive WB detected in | SKOV-3 cells |
| Positive IP detected in | SKOV-3 cells |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag3245 Product name: Recombinant human HOXB7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC015345 Sequence: MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE Predict reactive species |
| Full Name | homeobox B7 |
| Calculated Molecular Weight | 217 aa, 24 kDa |
| Observed Molecular Weight | 24-30 kDa |
| GenBank Accession Number | BC015345 |
| Gene Symbol | HOXB7 |
| Gene ID (NCBI) | 3217 |
| RRID | AB_2877867 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09629 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for HOXB7 antibody 12613-1-AP | Download protocol |
| IP protocol for HOXB7 antibody 12613-1-AP | Download protocol |
| WB protocol for HOXB7 antibody 12613-1-AP | Download protocol |
| rat | WB J Neuroinflammation Gene expression comparison reveals distinct basal expression of HOX members and differential TNF-induced response between brain- and spinal cord-derived microvascular endothelial cells. Authors - Yves Molino View Article |
| human | WB Front Oncol HOXB7 drives bladder cancer progression via H-Ras/ERK signaling: a potential therapeutic target and prognostic biomarker. Authors - Xulong Chen KD Validated View Article |
| Citations | 6 |
| Dilutions | WB : 1:500-1:3000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IF/ICC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
HOXB7 is a member of the homeobox family genes, which are often dysregulated in various cancer types. Particularly HOXB7 amplification and overexpression correlate with poor prognosis in various cancer such as gastric, pancreatic, and lung cancers. Moreover, HOXB7 is known to contribute to cancer progression by promoting epithelial to mesenchymal transition, anticancer drug resistance, and angiogenesis (PMID: 36659836). Protocols Product Specific Protocols IF protocol for HOXB7 antibody 12613-1-AP Download protocol IP protocol for HOXB7 antibody 12613-1-AP Download protocol WB protocol for HOXB7 antibody 12613-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Gene expression comparison reveals distinct basal expression of HOX members and differential TNF-induced response between brain- and spinal cord-derived microvascular endothelial cells.
Journal: J Neuroinflammation | Authors: Yves Molino | Species: rat | Application: WB - CircRNA hsa_circ_0070934 functions as a competitive endogenous RNA to regulate HOXB7 expression by sponging miR‑1236‑3p in cutaneous squamous cell carcinoma.
Journal: Int J Oncol | Authors: Da-Wei Zhang | Species: human | Application: WB - Long non-coding RNA BBOX1-AS1 exacerbates esophageal squamous cell carcinoma development by regulating HOXB7/β-catenin axis.
Journal: Exp Cell Res | Authors: Jinxiu Sheng | Species: human | Application: WB - Cell Cycle-Related Gene SPC24: A Novel Potential Diagnostic and Prognostic Biomarker for Laryngeal Squamous Cell Cancer
Journal: Biomed Res Int | Authors: Jialei Chen | Species: human | Application: WB,IHC - HOXB7 drives bladder cancer progression via H-Ras/ERK signaling: a potential therapeutic target and prognostic biomarker.
Journal: Front Oncol | Authors: Xulong Chen KD Validated | Species: human | Application: WB - Effect of HOXB7 in promoting proliferation, invasion and migration of cervical cancer cells.
Journal: Cytotechnology | Authors: Jing Zhang
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
