Mouse IGF-1 Recombinant monoclonal antibody, PBS Only (Detector) 85644-1-PBS proteintech
$699.00
In stock
SKU
85644-1-PBS
| Catalog Number | 85644-1-PBS |
| Synonyms | Igf1, IGF-I, Insulin-like growth factor I, Somatomedin |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg1939 Product name: Recombinant Mouse IGF1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 33-102 aa of Q8CAR0 Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA Predict reactive species |
| Full Name | insulin-like growth factor 1 |
| Calculated Molecular Weight | 18kd |
| GenBank Accession Number | Q8CAR0 |
| Gene Symbol | Igf1 |
| Gene ID (NCBI) | 16000 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8CAR0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242699F2 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
