IL-17B Recombinant monoclonal antibody 87094-1-RR proteintech
$149.00
In stock
SKU
87094-1-RR
| Catalog Number | 87094-1-RR |
| Synonyms | Cytokine CX1, Cytokine-like protein ZCYTO7, Il17b, Interleukin-17B, Neuronal interleukin-17-related factor |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Recombinant protein, Transfected with Mouse Il17b Transfected HEK-293T cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Positive WB detected in | Recombinant protein, Transfected with Mouse Il17b Transfected HEK-293T cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2785 Product name: recombinant mouse Il17b protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-180 aa of NM_019508.1 Sequence: RNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF Predict reactive species |
| Full Name | interleukin 17B |
| Calculated Molecular Weight | 20 kDa |
| GenBank Accession Number | NM_019508.1 |
| Gene Symbol | Il17b |
| Gene ID (NCBI) | 56069 |
| RRID | AB_3745333 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9QXT6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for IL-17B antibody 87094-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:1000-1:4000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251217F4 |
| Conjugation | Unconjugated |
The interleukin (IL)-17 superfamily, a relatively new family of cytokines, consists of six ligands (from IL-17A to IL-17F), which bind to five receptor subtypes (from IL-17RA to IL-17RE) and induce downstream signaling. IL-17B was originally described as increased during intestinal inflammation. Moreover, it stimulates TNF-α and IL-1β production by the human monocytic leukemia THP-1 cells and promotes neutrophil migration upon intraperitoneal administration, suggesting a pro-inflammatory role. More recent findings strongly suggest a role for the IL-17B/IL-17RB pathway in tumorigenesis. Protocols Product Specific Protocols WB protocol for IL-17B antibody 87094-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
