Integrin Alpha V Recombinant monoclonal antibody, PBS Only 84883-5-PBS proteintech
$699.00
In stock
SKU
84883-5-PBS
| Catalog Number | 84883-5-PBS |
| Synonyms | ITGAV, 242376D3, CD51, Integrin alpha-V, Integrin alpha-V heavy chain |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, IF/ICC, FC, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag25825 Product name: Recombinant human ITGAV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 819-915 aa of BC136442 Sequence: SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ Predict reactive species |
| Full Name | integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) |
| Calculated Molecular Weight | 1048 aa, 116 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC136442 |
| Gene Symbol | Integrin alpha V |
| Gene ID (NCBI) | 3685 |
| RRID | AB_3731330 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | P06756 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242376D3 |
| Conjugation | Unconjugated |
Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha V, also known as CD51, is a type I transmembrane glycoprotein composed of an extracellular domain, a transmembrane region and cytoplasmic domain (PMID: 2430295; 1690718). It can form heterodimers with one of the five beta integrin subunits (beta 1, 3, 5, 6, 8) that recognize ligands containing the sequence Arg-Gly-Asp, such as vitronectin, fibronectin, and osteopontin (PMID: 37087799). Integrin alpha V mainly plays a role in extracellular matrix-mediated cell adhesion and migration, differentiation, wound healing, inflammation, tumorigenesis, proliferation, angiogenesis, and metastasis.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
