KANK2 Polyclonal antibody 21733-1-AP proteintech
$149.00
In stock
SKU
21733-1-AP
| Catalog Number | 21733-1-AP |
| Synonyms | ANKRD25, KANK2, KIAA1518, MXRA3, SIP, SRC 1 interacting protein, SRC1 interacting protein |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse heart tissue, mouse kidney tissue, Transfected HEK-293 cells, mouse lung tissue |
| Tested Applications — Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells, A549 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | mouse heart tissue, mouse kidney tissue, Transfected HEK-293 cells, mouse lung tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, A549 cells |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag16416 Product name: Recombinant human KANK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC098105 Sequence: MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLRRVAVQRRPRLSSLPRGPGSWWTSTESLCSNASGDSRHSAYSYCGRGFYPQYGALETRGGFNPRVERTLLDARRRLEDQAATPTGLGSLTPSAAGSTASLVGVGLPPPTPRSSGLSTPVPPSAGHLAHVREQMAGALRKLRQLEEQVKLIPVLQVK Predict reactive species |
| Full Name | KN motif and ankyrin repeat domains 2 |
| Calculated Molecular Weight | 851 aa, 91 kDa |
| Observed Molecular Weight | 95-100 kDa |
| GenBank Accession Number | BC098105 |
| Gene Symbol | KANK2 |
| Gene ID (NCBI) | 25959 |
| RRID | AB_10732728 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q63ZY3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for KANK2 antibody 21733-1-AP | Download protocol |
| IHC protocol for KANK2 antibody 21733-1-AP | Download protocol |
| WB protocol for KANK2 antibody 21733-1-AP | Download protocol |
| mouse | WB Biochem Pharmacol From stem cells to skin: ADSCP6 peptide's role in transforming scar therapy Authors - Jun Li View Article |
| human | WB Am J Physiol Cell Physiol Itga8-Cre-mediated deletion of YAP and TAZ impairs bladder contractility with minimal inflammation and chondrogenic differentiation Authors - Li Liu View Article |
| Bryce (Verified Customer) (09-12-2022) | Strong band at expected molecular weight. Applications: Western Blot Primary Antibody Dilution: 1:1000 |
| Citations | 6 |
| Dilutions | WB : 1:500-1:3000 IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Involved in transcription regulation by sequestering nuclear receptor coactivators, such as NCOA1, NCOA2 and NCOA3, in the cytoplasm; the function is deregulated by phosphorylation. May be involved in the control of cytoskeleton formation by regulating actin polymerization. Involved in regulation of caspase-independent apoptosis; proposed to sequester AIFM1 in mitochondria and apoptotic stimuli lead to its proteasomal degradation allowing the release of AIFM1 to the nucleus. May be involved in promotion of cell proliferation. Protocols Product Specific Protocols IF protocol for KANK2 antibody 21733-1-AP Download protocol IHC protocol for KANK2 antibody 21733-1-AP Download protocol WB protocol for KANK2 antibody 21733-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The RNA-binding protein Fus directs translation of localized mRNAs in APC-RNP granules.
Journal: J Cell Biol | Authors: Yasuda Kyota K | Species: mouse | Application: WB,IF - An in vitro intestinal platform with a self-sustaining oxygen gradient to study the human gut/microbiome interface.
Journal: Biofabrication | Authors: Raehyun Kim | Application: IF - Nephrotic syndrome-associated mutation of KANK2 induces pathologic binding competition with physiological interactor KIF21A.
Journal: J Biol Chem | Authors: Yuqun Xu | Species: human | Application: WB - Knockout of the neonatal Fc Receptor (FcRn) in cultured podocytes alters IL-6 signaling and the actin cytoskeleton.
Journal: Am J Physiol Cell Physiol | Authors: Pantipa Tonsawan | Species: mouse | Application: WB - From stem cells to skin: ADSCP6 peptide's role in transforming scar therapy
Journal: Biochem Pharmacol | Authors: Jun Li | Species: mouse | Application: WB - Itga8-Cre-mediated deletion of YAP and TAZ impairs bladder contractility with minimal inflammation and chondrogenic differentiation
Journal: Am J Physiol Cell Physiol | Authors: Li Liu | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
