Cytokeratin 7 Monoclonal antibody, PBS Only (Detector) 68859-2-PBS proteintech
$699.00
In stock
SKU
68859-2-PBS
| Catalog Number | 68859-2-PBS |
| Synonyms | KRT7, Cytokeratin-7, Cytokeratin,Keratin, CK-7, CK7 |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17703 Product name: Recombinant human KRT7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-94 aa of BC002700 Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQ Predict reactive species |
| Full Name | keratin 7 |
| Calculated Molecular Weight | 469 aa, 51 kDa |
| GenBank Accession Number | BC002700 |
| Gene Symbol | Cytokeratin 7 |
| Gene ID (NCBI) | 3855 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P08729 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2C11G9 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
