Kindlin 2 Polyclonal antibody 29911-1-AP proteintech
$149.00
In stock
SKU
29911-1-AP
| Catalog Number | 29911-1-AP |
| Synonyms | FERMT2, FERMT 2, mig 2, Kindlin-2, kindlin2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells, HEK-293 cells, HeLa cells |
| Tested Applications — Positive IHC detected in | human lung cancer tissue, human normal colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | A549 cells, HEK-293 cells, HeLa cells |
| Positive IHC detected in | human lung cancer tissue, human normal colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag31795 Product name: Recombinant human Kindlin 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-441 aa of BC017327 Sequence: TSENHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNI Predict reactive species |
| Full Name | fermitin family homolog 2 (Drosophila) |
| Calculated Molecular Weight | 680 aa, 78 kDa |
| Observed Molecular Weight | 78 kDa |
| GenBank Accession Number | BC017327 |
| Gene Symbol | Kindlin 2 |
| Gene ID (NCBI) | 10979 |
| RRID | AB_3086186 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96AC1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Kindlin 2 antibody 29911-1-AP | Download protocol |
| WB protocol for Kindlin 2 antibody 29911-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:2000-1:12000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
FERMT2, also named as KIND2, MIG2, PLEKHC1, MIG-2 and Kindlin-2, belongs to the kindlin family. There are three FERMT2 isoforms that participate in the connection between extracellular matrix (ECM) adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. FERMT2 recruits migfilin (FBLP1) protein to cell-ECM focal adhesion sites. Variable expression in human cancers and mesenchymal cancer invasion are now linked with FERMT2, which may plays important role in carcinormas development. Protocols Product Specific Protocols IHC protocol for Kindlin 2 antibody 29911-1-AP Download protocol WB protocol for Kindlin 2 antibody 29911-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
