LASS2 Recombinant monoclonal antibody, PBS Only (Detector) 84514-3-PBS proteintech
$699.00
In stock
SKU
84514-3-PBS
| Catalog Number | 84514-3-PBS |
| Synonyms | Ceramide synthase 2, CerS2, EC:2.3.1.24, EC:2.3.1.297, Sphingosine N-acyltransferase CERS2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag14151 Product name: Recombinant human LASS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 315-380 aa of BC010032 Sequence: LHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKND Predict reactive species |
| Full Name | LAG1 homolog, ceramide synthase 2 |
| Calculated Molecular Weight | 380 aa, 45 kDa |
| GenBank Accession Number | BC010032 |
| Gene Symbol | LASS2 |
| Gene ID (NCBI) | 29956 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96G23 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241898D10 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
