LGALS3BP Recombinant monoclonal antibody, PBS Only 85883-1-PBS proteintech
$699.00
In stock
SKU
85883-1-PBS
| Catalog Number | 85883-1-PBS |
| Synonyms | 90K, BTBD17B, Galectin 3 binding protein, Galectin-3-binding protein, Lectin galactoside-binding soluble 3-binding protein |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg3302 Product name: Recombinant Human LGALS3BP protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-140 aa of NM_005567 Sequence: VNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELS Predict reactive species |
| Full Name | lectin, galactoside-binding, soluble, 3 binding protein |
| Calculated Molecular Weight | 585 aa, 65 kDa |
| GenBank Accession Number | NM_005567 |
| Gene Symbol | LGALS3BP |
| Gene ID (NCBI) | 3959 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q08380 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250138D9 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
