Mouse Ly-6A/E (Sca-1) Recombinant monoclonal antibody, PBS Only (Detector) 87403-2-PBS proteintech
$699.00
In stock
SKU
87403-2-PBS
| Catalog Number | 87403-2-PBS |
| Synonyms | PBS Only |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg4270 Product name: recombinant mouse Ly6a protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-112 aa of NM_001271416.1 Sequence: LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG Predict reactive species |
| Full Name | lymphocyte antigen 6 complex, locus A |
| Calculated Molecular Weight | 14 kDa |
| GenBank Accession Number | NM_001271416.1 |
| Gene Symbol | Ly6a |
| Gene ID (NCBI) | 110454 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P05533 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 252494A2 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
