MANEA Polyclonal antibody 21296-1-AP proteintech
$149.00
In stock
SKU
21296-1-AP
| Catalog Number | 21296-1-AP |
| Synonyms | Glycoprotein endo-alpha-1,2-mannosidase, Endomannosidase, Endo-alpha mannosidase, Endo alpha mannosidase, ENDO |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, mouse kidney tissue |
| Tested Applications — Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HEK-293 cells, mouse kidney tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag15847 Product name: Recombinant human MANEA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-109 aa of BC146671 Sequence: LRPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSETNTKNLKSVEITMKPSKASELNLDELPPLNNYLHVFYYS Predict reactive species |
| Full Name | mannosidase, endo-alpha |
| Calculated Molecular Weight | 462 aa, 54 kDa |
| Observed Molecular Weight | 54 kDa |
| GenBank Accession Number | BC146671 |
| Gene Symbol | MANEA |
| Gene ID (NCBI) | 79694 |
| RRID | AB_2878836 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5SRI9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for MANEA antibody 21296-1-AP | Download protocol |
| IHC protocol for MANEA antibody 21296-1-AP | Download protocol |
| WB protocol for MANEA antibody 21296-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:200-1:1000 IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
