MSI1 Recombinant monoclonal antibody, PBS Only (Detector) 86723-2-PBS proteintech
$699.00
In stock
SKU
86723-2-PBS
| Catalog Number | 86723-2-PBS |
| Synonyms | Musashi 1, musashi homolog 1 (Drosophila), Musashi-1, RNA-binding protein Musashi homolog 1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | IF/ICC, Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag26042 Product name: Recombinant human MSI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-83 aa of BC146463 Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRH Predict reactive species |
| Full Name | musashi homolog 1 (Drosophila) |
| Calculated Molecular Weight | 362 aa, 39 kDa |
| GenBank Accession Number | BC146463 |
| Gene Symbol | MSI1 |
| Gene ID (NCBI) | 4440 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O43347 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251695G5 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
