P glycoprotein Monoclonal antibody, PBS Only (Detector) 67258-4-PBS proteintech
$699.00
In stock
SKU
67258-4-PBS
| Catalog Number | 67258-4-PBS |
| Synonyms | ABCB1, ATP-binding cassette sub-family B member 1, ATP-dependent translocase ABCB1, EC:7.6.2.1, EC:7.6.2.2 |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17811 Product name: Recombinant human ABCB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 624-708 aa of BC130424 Sequence: KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW Predict reactive species |
| Full Name | ATP-binding cassette, sub-family B (MDR/TAP), member 1 |
| Calculated Molecular Weight | 1280 aa, 142 kDa |
| GenBank Accession Number | BC130424 |
| Gene Symbol | P glycoprotein |
| Gene ID (NCBI) | 5243 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P08183 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 2H10D12 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
