NDUFS6 Monoclonal antibody 68329-1-Ig proteintech
$149.00
In stock
SKU
68329-1-Ig
| Catalog Number | 68329-1-Ig |
| Synonyms | 2F4H3, CI 13kD A, CI-13kD-A, Complex I 13kD A, Complex I-13kD-A |
| Host | Mouse |
| Reactivity | human, mouse, rat, rabbit, chicken |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | rabbit heart tissue, HepG2 cells, rat heart tissue, mouse heart tissue, chicken heart tissue |
| Tested Applications — Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Positive WB detected in | rabbit heart tissue, HepG2 cells, rat heart tissue, mouse heart tissue, chicken heart tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Tested Reactivity | human, mouse, rat, rabbit, chicken |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag6286 Product name: Recombinant human NDUFS6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-124 aa of BC046155 Sequence: MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 13-15 kDa |
| GenBank Accession Number | BC046155 |
| Gene Symbol | NDUFS6 |
| Gene ID (NCBI) | 4726 |
| RRID | AB_2935401 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | O75380 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for NDUFS6 antibody 68329-1-Ig | Download protocol |
| IHC protocol for NDUFS6 antibody 68329-1-Ig | Download protocol |
| WB protocol for NDUFS6 antibody 68329-1-Ig | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:500-1:2000 IF/ICC : 1:400-1:1600 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2F4H3 |
| Conjugation | Unconjugated |
NDUFS6(NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial) is also named as CI-13kD-A, NADH-ubiquinone oxidoreductase 13 kDa-A subunit and belongs to the complex I NDUFS6 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Protocols Product Specific Protocols IF protocol for NDUFS6 antibody 68329-1-Ig Download protocol IHC protocol for NDUFS6 antibody 68329-1-Ig Download protocol WB protocol for NDUFS6 antibody 68329-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
