CDKN2A/P16-INK4A Polyclonal antibody 30519-1-AP proteintech
$149.00
In stock
SKU
30519-1-AP
| Catalog Number | 30519-1-AP |
| Synonyms | p16, p16 INK4, P16 INK4A, p16-INK4, p16INK4A |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HeLa cells, SMMC-7721 cells |
| Tested Applications — Positive IP detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Positive WB detected in | HEK-293 cells, HeLa cells, SMMC-7721 cells |
| Positive IP detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag29567 Product name: Recombinant human P16-INK4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 55-156 aa of NM_000077 Sequence: SARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD Predict reactive species |
| Full Name | cyclin-dependent kinase inhibitor 2A |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | NM_000077 |
| Gene Symbol | CDKN2A |
| Gene ID (NCBI) | 1029 |
| RRID | AB_3086346 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42771 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IP protocol for CDKN2A/P16-INK4A antibody 30519-1-AP | Download protocol |
| WB protocol for CDKN2A/P16-INK4A antibody 30519-1-AP | Download protocol |
| human | WB J Transl Med Targeting PURPL RNA enabled rejuvenation of senescence cells via epigenetic reprogramming. Authors - Jie Wang View Article |
| Citations | 9 |
| Dilutions | WB : 1:1000-1:6000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
P16-INK4A is also named as CDKN2A, MLM, Tumor suppressor ARF, Alternative reading frame. The tumor suppressor protein p16Ink4a (encoded from the CDKN2A locus) is often transcriptionally activated in cells undergoing senescence and is one of the main regulators of this program, and it is upregulated in multiple tissues during aging (PMID:17055429). p16-Ink4a is the principal member of the Ink4 family of CDK inhibitors. p16-Ink4a contributes to the regulation of cell cycle progression by inhibiting the S phase. p16Ink4a binds to CDK4/6, inhibiting cyclin D-CDK4/6 complex formation and CDK4/6-mediated phosphorylation of Rb family members. Expression of p16-Ink4a maintains the Rb family members in a hypophosphorylated state, which promotes binding to E2F1 and leads to G1 cell cycle arrest (PMID: 21297668). Protocols Product Specific Protocols IP protocol for CDKN2A/P16-INK4A antibody 30519-1-AP Download protocol WB protocol for CDKN2A/P16-INK4A antibody 30519-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Suppression of GATA3 promotes epithelial-mesenchymal transition and simultaneous cellular senescence in human extravillous trophoblasts
Journal: Biochim Biophys Acta Mol Cell Res | Authors: En-Xiang Chen | Species: human | Application: WB - Molecular changes of cellular senescence in dental pulp stem cells during in vitro culture: A potential role of PSG4
Journal: Tissue Cell | Authors: Xiaolin Lyu | Species: human | Application: WB - Targeting PURPL RNA enabled rejuvenation of senescence cells via epigenetic reprogramming.
Journal: J Transl Med | Authors: Jie Wang | Species: human | Application: WB - Glucocorticoid impairs angiogenesis-dependent osteogenesis by downregulating EphB4 in endothelial cells.
Journal: Biochem Pharmacol | Authors: Qinghua Ren | Application: WB,IF - Identifying ENO1 as a protein target of chlorogenic acid to inhibit cellular senescence and prevent skin photoaging in mice
Journal: Aging Cell | Authors: Xueling He | Application: IHC - Pro-Xylane alleviates ultraviolet-induced skin senescence through SGK1-mediated p21 ubiquitination and subcellular translocation.
Journal: Mech Ageing Dev | Authors: Tingting Wang - WTAP Contributes to Periodontitis Pathogenesis by Promoting PDLSC Senescence and Impairing Osteogenic Differentiation via m6A-Dependent Regulation of TP53BP1.
Journal: Immun Inflamm Dis | Authors: Menglin Xiong | Species: human | Application: WB - Molecular changes of cellular senescence in dental pulp stem cells during in vitro culture: A potential role of PSG4
Journal: Tissue Cell | Authors: Xiaolin Lyu | Species: human | Application: WB - FOXO1 contributes to cigarette smoke condensate-induced cellular senescence and fibrosis in lung fibroblasts through activating the TGF-β1/Smad2/3 signaling pathway
Journal: Immunol Res | Authors: Mengning Zheng | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
