SCN3B Recombinant monoclonal antibody, PBS Only 82959-3-PBS proteintech
$699.00
In stock
SKU
82959-3-PBS
| Catalog Number | 82959-3-PBS |
| Synonyms | HSA243396, KIAA1158, SCNB3, Sodium channel regulatory subunit beta-3, Sodium channel subunit beta 3 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag23201 Product name: Recombinant human SCN3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-93 aa of BC126265 Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ Predict reactive species |
| Full Name | sodium channel, voltage-gated, type III, beta |
| Calculated Molecular Weight | 25 kDa |
| GenBank Accession Number | BC126265 |
| Gene Symbol | SCN3B |
| Gene ID (NCBI) | 55800 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NY72 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230316D1 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
