PARP14 Recombinant monoclonal antibody, PBS Only (Detector) 84039-1-PBS proteintech
$699.00
In stock
SKU
84039-1-PBS
| Catalog Number | 84039-1-PBS |
| Synonyms | BAL2, KIAA1268, PARP 14 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag35007 Product name: Recombinant human PARP14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1501-1640 aa of NM_017554 Sequence: SRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTC Predict reactive species |
| Full Name | poly (ADP-ribose) polymerase family, member 14 |
| Calculated Molecular Weight | 203kd |
| GenBank Accession Number | NM_017554 |
| Gene Symbol | PARP14 |
| Gene ID (NCBI) | 54625 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q460N5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241078B2 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
