CCM3/PDCD10 Polyclonal antibody 10294-2-AP proteintech
$149.00
In stock
SKU
10294-2-AP
| Catalog Number | 10294-2-AP |
| Synonyms | CCM3, CCM3/PDCD10, PDCD10, programmed cell death 10, TFAR15 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IP, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | MCF-7 cells, PC-3 cells, Raji cells |
| Tested Applications — Positive IP detected in | MCF-7 cells |
| Tested Applications — Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | MCF-7 cells, PC-3 cells, Raji cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag0348 Product name: Recombinant human PDCD10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 9-101 aa of BC002506 Sequence: KNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQ Predict reactive species |
| Full Name | programmed cell death 10 |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC002506 |
| Gene Symbol | PDCD10 |
| Gene ID (NCBI) | 11235 |
| RRID | AB_2162153 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BUL8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CCM3/PDCD10 antibody 10294-2-AP | Download protocol |
| IP protocol for CCM3/PDCD10 antibody 10294-2-AP | Download protocol |
| WB protocol for CCM3/PDCD10 antibody 10294-2-AP | Download protocol |
| mouse | WB Aging (Albany NY) PDCD10 promotes the aggressive behaviors of pituitary adenomas by up-regulating CXCR2 and activating downstream AKT/ERK signaling Authors - Jingdian Liu KO Validated View Article |
| human,mouse | WB,IHC J Clin Invest Mutations in 2 distinct genetic pathways result in cerebral cavernous malformations in mice. Authors - Chan Aubrey C AC KD Validated View Article |
| rat | WB Cell Rep The STRIPAK complex is required for radial sorting and laminin receptor expression in Schwann cells Authors - Michael R Weaver View Article |
| human,rat | WB,IF J Cell Sci CCM3/PDCD10 stabilizes GCKIII proteins to promote Golgi assembly and cell orientation. Authors - Fidalgo Miguel M KD Validated View Article |
| Citations | 22 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
PDCD10, also named CCM3 and TFAR15, belongs to the PDCD10 family. PDCD10 promotes cell proliferation, increases MAPK activity and modulates apoptotic pathways. PDCD10 is important for cell migration and for normal structure and assembly of the Golgi complex. PDCD10 is required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development, moreover, defects in PDCD10 showed abnormal cardiovascular development. Catalog#10294-2-AP is a rabbit polyclonal antibody raised against the full-length PDCD10 of human origin. Protocols Product Specific Protocols IHC protocol for CCM3/PDCD10 antibody 10294-2-AP Download protocol IP protocol for CCM3/PDCD10 antibody 10294-2-AP Download protocol WB protocol for CCM3/PDCD10 antibody 10294-2-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- CCM3 is a gatekeeper in focal adhesions regulating mechanotransduction and YAP/TAZ signalling.
Journal: Nat Cell Biol | Authors: Shan Wang KO Validated | Species: mouse | Application: WB - Mutations in 2 distinct genetic pathways result in cerebral cavernous malformations in mice.
Journal: J Clin Invest | Authors: Chan Aubrey C AC KD Validated | Species: human,mouse | Application: WB,IHC - The STRIPAK complex is required for radial sorting and laminin receptor expression in Schwann cells
Journal: Cell Rep | Authors: Michael R Weaver | Species: rat | Application: WB - Ccm3, a gene associated with cerebral cavernous malformations, is required for neuronal migration.
Journal: Development | Authors: Angeliki Louvi KO Validated | Species: mouse | Application: WB - PDCD10 promotes the aggressive behaviors of pituitary adenomas by up-regulating CXCR2 and activating downstream AKT/ERK signaling
Journal: Aging (Albany NY) | Authors: Jingdian Liu KO Validated | Species: mouse | Application: WB - CCM3/PDCD10 stabilizes GCKIII proteins to promote Golgi assembly and cell orientation.
Journal: J Cell Sci | Authors: Fidalgo Miguel M KD Validated | Species: human,rat | Application: WB,IF - PDCD10 promotes the aggressive behaviors of pituitary adenomas by up-regulating CXCR2 and activating downstream AKT/ERK signaling
Journal: Aging (Albany NY) | Authors: Jingdian Liu | Species: mouse | Application: WB - Cerebral cavernous malformation 3 relieves subarachnoid hemorrhage-induced neuroinflammation in rats through inhibiting NF-kB signaling pathway.
Journal: Brain Res Bull | Authors: Wei Peng | Species: mouse,rat | Application: WB,IF - Connexin 43 gap junctions contribute to brain endothelial barrier hyperpermeability in familial cerebral cavernous malformations type III by modulating tight junction structure.
Journal: FASEB J | Authors: Allison M Johnson | Species: mouse | Application: WB - Amplification of protease-activated receptors signaling in sporadic cerebral cavernous malformation endothelial cells
Journal: Biochim Biophys Acta Mol Cell Res | Authors: Concetta Scimone | Species: human | Application: WB - PDCD10/CCM3 acts downstream of {gamma}-protocadherins to regulate neuronal survival.
Journal: J Biol Chem | Authors: Lin Chengyi C | Species: human | Application: WB,IHC - Adaptor protein cerebral cavernous malformation 3 (CCM3) mediates phosphorylation of the cytoskeletal proteins ezrin/radixin/moesin by mammalian Ste20-4 to protect cells from oxidative stress.
Journal: J Biol Chem | Authors: Fidalgo Miguel M | Species: human | Application: WB - Ccm3, a gene associated with cerebral cavernous malformations, is required for neuronal migration.
Journal: Development | Authors: Angeliki Louvi | Species: mouse | Application: WB - A novel non-canonical mechanism of regulation of MST3 (mammalian Sterile20-related kinase 3).
Journal: Biochem J | Authors: Fuller Stephen J SJ | Species: rat | Application: WB - CCM3/PDCD10 stabilizes GCKIII proteins to promote Golgi assembly and cell orientation.
Journal: J Cell Sci | Authors: Fidalgo Miguel M | Species: human,rat | Application: WB,IF - New Function Annotation of PROSER2 in Pancreatic Ductal Adenocarcinoma
Journal: J Proteome Res | Authors: Yu-Sun Lee | Species: human | Application: IF - Arsenic-induced anti-angiogenesis via miR-425-5p-regulated CCM3.
Journal: Toxicol Lett | Authors: Yanfang Gao - Transcriptome Analysis Reveals Altered Expression of Genes Involved in Hypoxia, Inflammation and Immune Regulation in Pdcd10-Depleted Mouse Endothelial Cells.
Journal: Genes (Basel) | Authors: Carmela Fusco | Species: mouse | Application: WB - Relationship between CCM3 expression and angiogenesis in esophageal squamous cell carcinoma and its possible mechanism.
Journal: Int J Clin Oncol | Authors: Muhammad Saud Tabish - A single-center study on 140 patients with cerebral cavernous malformations: 28 new pathogenic variants and functional characterization of a PDCD10 large deletion .
Journal: Hum Mutat | Authors: Grazia Nardella | Species: human | Application: WB - Programmed Cell Death 10 (PDCD10) Is a Candidate Tumor-associated Gene in Esophageal Squamous Cell Carcinoma
Journal: Anticancer Res | Authors: Yoshiki Hiraki | Species: human | Application: IHC - The STRIPAK complex is required for radial sorting and laminin receptor expression in Schwann cells
Journal: bioRxiv | Authors: Michael R Weaver | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
