CoraLite®594-conjugated PSMD9 Monoclonal antibody CL594-67338 proteintech
$479.00
In stock
SKU
CL594-67338
| Catalog Number | CL594-67338 |
| Synonyms | Rpn4, p27, 26S proteasome non-ATPase regulatory subunit 9, 1H2G1 |
| Host | Mouse |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive IF/ICC detected in | U2OS cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF/ICC detected in | U2OS cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25654 Product name: Recombinant human PSMD9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-102 aa of BC004213 Sequence: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHA Predict reactive species |
| Full Name | proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC004213 |
| Gene Symbol | PSMD9 |
| Gene ID (NCBI) | 5715 |
| RRID | AB_3084760 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Purification Method | Protein G purification |
| UNIPROT ID | O00233 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL594 PSMD9 antibody CL594-67338 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1H2G1 |
| Conjugation | CoraLite®594 |
PSMD9 is a ubiquitous protein of eukaryotic cells and is a chaperon of the 26S proteasome complex, which degrades ubiquitinated proteins in eukaryotic cells and contributes to the degradation of intracellular proteins into antigenic peptides for antigen presentation by MHC class I cells. The 26S mammalian base sub-complex involves three distinct modules which have ATPase subunits distinctly associated to three chaperones, one of which is PSMD9 regulating the modules assembly. The PSMD9 ubiquitous regulatory role within the proteasome implies its potential pleiotropic effects within different physio-pathological systems. PSMD9 is known to form a stable subcomplex with PSMC3 and PSMC6, two of the AAA-ATPases, assisting in the assembly of the 20S and 19S particles to form the holo complex. Protocols Product Specific Protocols IF protocol for CL594 PSMD9 antibody CL594-67338 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
