RAB39B Polyclonal antibody 12162-1-AP proteintech
$149.00
In stock
SKU
12162-1-AP
| Catalog Number | 12162-1-AP |
| Synonyms | Ras related protein Rab 39B, Ras-related protein Rab-39B |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | fetal human brain tissue, mouse brain tissue, Y79 cells, human brain tissue |
| Tested Applications — Positive IP detected in | SH-SY5Y cells, mouse brain tissue |
| Tested Applications — Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | fetal human brain tissue, mouse brain tissue, Y79 cells, human brain tissue |
| Positive IP detected in | SH-SY5Y cells, mouse brain tissue |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2803 Product name: Recombinant human RAB39B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC009714 Sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC Predict reactive species |
| Full Name | RAB39B, member RAS oncogene family |
| Calculated Molecular Weight | 213 aa, 25 kDa |
| Observed Molecular Weight | 25 kDa |
| GenBank Accession Number | BC009714 |
| Gene Symbol | RAB39B |
| Gene ID (NCBI) | 116442 |
| RRID | AB_2177360 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96DA2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for RAB39B antibody 12162-1-AP | Download protocol |
| IP protocol for RAB39B antibody 12162-1-AP | Download protocol |
| WB protocol for RAB39B antibody 12162-1-AP | Download protocol |
| human | WB,IF Brain Pathol RAB39B is redistributed in dementia with Lewy bodies and is sequestered within aβ plaques and Lewy bodies. Authors - David J Koss View Article |
| mouse | WB,IF Acta Neuropathol Commun Synaptic localization of C9orf72 regulates post-synaptic glutamate receptor 1 levels. Authors - Shangxi Xiao View Article |
| David (Verified Customer) (09-25-2019) | The antibodiy works well in membrane enriched fractionates generated from human brain homogenate. Note that several higher molecular weight bands are seen when using crude lysates generated from the same samples.Image details: lane 1 = molecular weight ladder, lanes 2-7 = membrane enriched fractionates (2µg/lane).Membrane blocked in 5% milk powder containing TBST overnight at 4oC. Primary antibody: RAB39B (1:1000) in 5% BSA containing TBST, 1hr incubation at RT. Secondar antibody: y Goat anti Rabbit-HRP (1:5000, 1hr RT) in 5% milk powder containing TBST. Applications: Western Blot, Primary Antibody Dilution: 1:1000 Cell Tissue Type: Human brain tissue RAB39B Antibody Western Blot, validation (1:1000 dilution) in Human brain tissue (Cat no:12162-1-AP) |
| Citations | 14 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- C9orf72-catalyzed GTP loading of Rab39A enables HOPS-mediated membrane tethering and fusion in mammalian autophagy
Journal: Nat Commun | Authors: Shen Zhang KO Validated | Species: human | Application: WB - Mutations in RAB39B Cause X-Linked Intellectual Disability and Early-Onset Parkinson Disease with α-Synuclein Pathology.
Journal: Am J Hum Genet | Authors: Gabrielle R Wilson | Species: mouse | Application: WB - Loss of C9ORF72 impairs autophagy and synergizes with polyQ Ataxin-2 to induce motor neuron dysfunction and cell death.
Journal: EMBO J | Authors: Chantal Sellier | Species: human | Application: IP - Clinical and Neuropathological Features Associated With Loss of RAB39B.
Journal: Mov Disord | Authors: Yujing Gao | Species: human | Application: WB - Synaptic localization of C9orf72 regulates post-synaptic glutamate receptor 1 levels.
Journal: Acta Neuropathol Commun | Authors: Shangxi Xiao | Species: mouse | Application: WB,IF - RAB39B is redistributed in dementia with Lewy bodies and is sequestered within aβ plaques and Lewy bodies.
Journal: Brain Pathol | Authors: David J Koss | Species: human | Application: WB,IF - Synaptic localization of C9orf72 regulates post-synaptic glutamate receptor 1 levels.
Journal: Acta Neuropathol Commun | Authors: Shangxi Xiao | Species: mouse | Application: WB,IF - Absence of Rab39b-induced macroautophagy impairment increases neurotoxic α-synuclein and causes degeneration of substantia nigra dopaminergic neurons in mouse model of X-linked Parkinson's disease
Journal: Life Sci | Authors: Ching-Chi Chiu | Species: mouse | Application: WB - RAB39B Deficiency Impairs Learning and Memory Partially Through Compromising Autophagy.
Journal: Front Cell Dev Biol | Authors: Mengxi Niu | Species: mouse | Application: WB - RAB39B is redistributed in dementia with Lewy bodies and is sequestered within aβ plaques and Lewy bodies.
Journal: Brain Pathol | Authors: David J Koss | Species: human | Application: WB,IF - Increased level of RAB39B leads to neuronal dysfunction and behavioural changes in mice
Journal: J Cell Mol Med | Authors: Zijie Wang | Species: mouse | Application: WB - Distribution of Parkinson's disease associated RAB39B in mouse brain tissue.
Journal: Mol Brain | Authors: Yujing Gao | Species: mouse | Application: WB,IF - Identification and characterisation of multiple novel Rab-myosin Va interactions.
Journal: Mol Biol Cell | Authors: Lindsay Andrew J AJ | Species: human | Application: IF - RAB39B: A novel biomarker for acute myeloid leukemia identified via multi-omics and functional validation
Journal: Open Med (Wars) | Authors: Shuo Chen | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
