Calcipressin 1 Polyclonal antibody 14869-1-AP proteintech
$149.00
In stock
SKU
14869-1-AP
| Catalog Number | 14869-1-AP |
| Synonyms | ADAPT78, Calcipressin 1, CSP1, DSC1, DSCR1, MCIP1, RCAN1, RCN1, regulator of calcineurin 1 |
| Host | Rabbit |
| Reactivity | human, mouse and More (2) |
| Reactivity | human, mouse, rat, sheep |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IP, ELISA |
| Applications | WB, IP, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, SKOV-3 cells, human heart tissue, mouse skeletal muscle tissue, mouse heart tissue, A431 cells, mouse cerebellum tissue |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse brain tissue, SKOV-3 cells, human heart tissue, mouse skeletal muscle tissue, mouse heart tissue, A431 cells, mouse cerebellum tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, sheep |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag6457 Product name: Recombinant human RCAN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-197 aa of BC002864 Sequence: MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS Predict reactive species |
| Full Name | regulator of calcineurin 1 |
| Calculated Molecular Weight | 28 kDa |
| Observed Molecular Weight | 25-29 kDa |
| GenBank Accession Number | BC002864 |
| Gene Symbol | RCAN1 |
| Gene ID (NCBI) | 1827 |
| RRID | AB_10640904 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P53805 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Calcipressin 1 antibody 14869-1-AP | Download protocol |
| IP protocol for Calcipressin 1 antibody 14869-1-AP | Download protocol |
| WB protocol for Calcipressin 1 antibody 14869-1-AP | Download protocol |
| mouse | WB Biol Sex Differ Mapping the hippocampal spatial proteomic signature in male and female mice of an early Alzheimer's disease model Authors - Ana Contreras View Article |
| human | WB Front Med (Lausanne) The identification of hub-methylated differentially expressed genes in osteoarthritis patients is based on epigenomic and transcriptomic data Authors - Zhen-Chen Chu View Article |
| sheep | WB Animals (Basel) DIA Proteomics Reveals the Mechanism of cAMP Signaling Pathway-Mediated HPT Axis in Regulating Spermatogenesis of Hu Sheep. Authors - Lina Zhu View Article |
| rat | WB Biomed Mater Dynamic stiffness drives BMSC chondrogenesis viaIhh-regulated H3K18 lactylation/Rcan1axis and mitochondrial fission remodeling. Authors - Liyang Chen View Article |
| Xu (Verified Customer) (10-06-2020) | It can produce a clear band in mouse brain with a stronger one in Ts65Dn mouse due to gene dose. Applications: Western Blot Primary Antibody Dilution: 1:1500 Cell Tissue Type: mouse brain Calcipressin 1 Antibody Western Blot validation (1:1500 dilution) in mouse brain (Cat no:14869-1-AP) |
| Citations | 5 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- N6-methyladenosine modification of SPOP relieves ferroptosis and diabetic cardiomyopathy by enhancing ubiquitination of VDAC3
Journal: Free Radic Biol Med | Authors: Wei Meng | Species: mouse | Application: WB - The identification of hub-methylated differentially expressed genes in osteoarthritis patients is based on epigenomic and transcriptomic data
Journal: Front Med (Lausanne) | Authors: Zhen-Chen Chu | Species: human | Application: WB - DIA Proteomics Reveals the Mechanism of cAMP Signaling Pathway-Mediated HPT Axis in Regulating Spermatogenesis of Hu Sheep.
Journal: Animals (Basel) | Authors: Lina Zhu | Species: sheep | Application: WB - Mapping the hippocampal spatial proteomic signature in male and female mice of an early Alzheimer's disease model
Journal: Biol Sex Differ | Authors: Ana Contreras | Species: mouse | Application: WB - Dynamic stiffness drives BMSC chondrogenesis viaIhh-regulated H3K18 lactylation/Rcan1axis and mitochondrial fission remodeling.
Journal: Biomed Mater | Authors: Liyang Chen | Species: rat | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
