ROMO1 Polyclonal antibody 24200-1-AP proteintech
$149.00
In stock
SKU
24200-1-AP
| Catalog Number | 24200-1-AP |
| Synonyms | C20orf52, Epididymis tissue protein Li 175, Glyrichin, Mitochondrial targeting GxxxG motif protein, MTGM |
| Host | Rabbit |
| Reactivity | human and More (2) |
| Reactivity | human, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells |
| Tested Applications — Positive IHC detected in | human lung cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | HEK-293 cells |
| Positive IHC detected in | human lung cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human, rat, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag20368 Product name: Recombinant human ROMO1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-79 aa of BC008488 Sequence: MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC Predict reactive species |
| Full Name | reactive oxygen species modulator 1 |
| Calculated Molecular Weight | 79 aa, 8 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC008488 |
| Gene Symbol | ROMO1 |
| Gene ID (NCBI) | 140823 |
| RRID | AB_2879453 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60602 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for ROMO1 antibody 24200-1-AP | Download protocol |
| WB protocol for ROMO1 antibody 24200-1-AP | Download protocol |
| human | WB J Cell Biol ROMO1 is a constituent of the human presequence translocase required for YME1L protease import. Authors - Frank Richter KD Validated View Article |
| rat | WB Neurochem Res NL-1 Promotes PINK1-Parkin-Mediated Mitophagy Through MitoNEET Inhibition in Subarachnoid Hemorrhage Authors - Tongyu Zhang View Article |
| pig | WB,IF Cell Div ROMO1 is required for mitochondrial metabolism during preimplantation embryo development in pigs. Authors - Dongjie Zhou KD Validated View Article |
| Citations | 8 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- TRAF2 inhibits senescence in hepatocellular carcinoma cells via regulating the ROMO1/ NAD+/SIRT3/SOD2 axis
Journal: Free Radic Biol Med | Authors: Jiping Yao KD Validated | Species: human | Application: WB - NL-1 Promotes PINK1-Parkin-Mediated Mitophagy Through MitoNEET Inhibition in Subarachnoid Hemorrhage
Journal: Neurochem Res | Authors: Tongyu Zhang | Species: rat | Application: WB - ROMO1 is required for mitochondrial metabolism during preimplantation embryo development in pigs.
Journal: Cell Div | Authors: Dongjie Zhou KD Validated | Species: pig | Application: WB,IF - The Inhibition of Reactive Oxygen Species Modulator 1 Attenuates Sevoflurane-Induced Neural Injury via Reducing Apoptosis and Oxidative Stress
Journal: J Mol Neurosci | Authors: Lingyan Gu | Species: human | Application: WB - Metal-organic framework-encapsulated dihydroartemisinin nanoparticles induces apoptotic cell death in ovarian cancer by blocking ROMO1-mediated ROS production
Journal: J Nanobiotechnology | Authors: Yuanliang Yan | Species: human | Application: WB - ROMO1 is a constituent of the human presequence translocase required for YME1L protease import.
Journal: J Cell Biol | Authors: Frank Richter KD Validated | Species: human | Application: WB - NL-1 Promotes PINK1-Parkin-Mediated Mitophagy Through MitoNEET Inhibition in Subarachnoid Hemorrhage
Journal: Neurochem Res | Authors: Tongyu Zhang | Species: rat | Application: WB - The Inhibition of Reactive Oxygen Species Modulator 1 Attenuates Sevoflurane-Induced Neural Injury via Reducing Apoptosis and Oxidative Stress
Journal: J Mol Neurosci | Authors: Lingyan Gu | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
