RUVBL2 Polyclonal antibody 10195-1-AP proteintech
$149.00
In stock
SKU
10195-1-AP
| Catalog Number | 10195-1-AP |
| Synonyms | RUVB2, 48 kDa TATA box-binding protein-interacting protein, 48 kDa TBP-interacting protein, CGI-46, EC:3.6.4.12 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | C2C12 cells, Daudi cells, HeLa cells, HepG2 cells |
| Tested Applications — Positive IP detected in | HeLa cells, mouse brain tissue |
| Tested Applications — Positive IHC detected in | rat bladder tissue, human gliomas tissue, human placenta tissue, mouse bladder tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | C2C12 cells, Daudi cells, HeLa cells, HepG2 cells |
| Positive IP detected in | HeLa cells, mouse brain tissue |
| Positive IHC detected in | rat bladder tissue, human gliomas tissue, human placenta tissue, mouse bladder tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag0253 Product name: Recombinant human RUVBL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-463 aa of BC000428 Sequence: SQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS Predict reactive species |
| Full Name | RuvB-like 2 (E. coli) |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC000428 |
| Gene Symbol | RUVBL2 |
| Gene ID (NCBI) | 10856 |
| RRID | AB_2184679 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y230 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for RUVBL2 antibody 10195-1-AP | Download protocol |
| IHC protocol for RUVBL2 antibody 10195-1-AP | Download protocol |
| IP protocol for RUVBL2 antibody 10195-1-AP | Download protocol |
| WB protocol for RUVBL2 antibody 10195-1-AP | Download protocol |
| mouse | WB EMBO J LncRNA HAND2-AS1 promotes liver cancer stem cell self-renewal via BMP signaling. Authors - Yanying Wang View Article |
| human | WB Sci Adv ETV7 is an essential component of a rapamycin-insensitive mTOR complex in cancer. Authors - Franklin C Harwood View Article |
| Deyong (Verified Customer) (03-11-2022) | It worked well in H1 human embryonic stem cells. Applications: Western Blot Primary Antibody Dilution: 1/1000 Cell Tissue Type: Human embryonic stem cell |
| Citations | 28 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:250-1:1000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
RuvB-like 2 (E. coli) (RUVBL2, synonyms: ECP51, TIP48, CGI-46, TIP49B) is the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that RUVBL2 has both ATPase and DNA helicase activities. Protocols Product Specific Protocols IF protocol for RUVBL2 antibody 10195-1-AP Download protocol IHC protocol for RUVBL2 antibody 10195-1-AP Download protocol IP protocol for RUVBL2 antibody 10195-1-AP Download protocol WB protocol for RUVBL2 antibody 10195-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Metabolic stress controls mTORC1 lysosomal localization and dimerization by regulating the TTT-RUVBL1/2 complex.
Journal: Mol Cell | Authors: Sang Gyun Kim | Species: mouse | Application: WB - Synthetic lethality by targeting the RUVBL1/2-TTT complex in mTORC1-hyperactive cancer cells.
Journal: Sci Adv | Authors: Seung Ho Shin KD Validated | Species: human | Application: WB,IF - Inhibition of the CDK2 and Cyclin A complex leads to autophagic degradation of CDK2 in cancer cells.
Journal: Nat Commun | Authors: Jiawei Zhang | Species: human | Application: WB,IP - circular RNA cia-MAF drives self-renewal and metastasis of liver tumor-initiating cells via transcription factor MAFF.
Journal: J Clin Invest | Authors: Zhenzhen Chen | Species: mouse | Application: IP - ETV7 is an essential component of a rapamycin-insensitive mTOR complex in cancer.
Journal: Sci Adv | Authors: Franklin C Harwood | Species: human | Application: WB - LncRNA HAND2-AS1 promotes liver cancer stem cell self-renewal via BMP signaling.
Journal: EMBO J | Authors: Yanying Wang | Species: mouse | Application: WB - circular RNA cia-MAF drives self-renewal and metastasis of liver tumor-initiating cells via transcription factor MAFF.
Journal: J Clin Invest | Authors: Zhenzhen Chen | Species: mouse | Application: IP - Synthetic lethality by targeting the RUVBL1/2-TTT complex in mTORC1-hyperactive cancer cells.
Journal: Sci Adv | Authors: Seung Ho Shin | Species: human | Application: WB,IF - ETV7 is an essential component of a rapamycin-insensitive mTOR complex in cancer.
Journal: Sci Adv | Authors: Franklin C Harwood | Species: human | Application: WB - PIWIL1 activates the R2TP-TELO2-mTORC1 axis independently of piRNA to promote TOP mRNA translation in gastric cancer
Journal: Oncogene | Authors: Tianqu Fan | Species: human | Application: WB - LncRNA HAND2-AS1 promotes liver cancer stem cell self-renewal via BMP signaling.
Journal: EMBO J | Authors: Yanying Wang | Species: mouse | Application: WB - Multilevel regulation of RUVBL2 expression predicts poor prognosis in hepatocellular carcinoma.
Journal: Cancer Cell Int | Authors: Tao Yan | Species: human | Application: IHC - The Hsp90 chaperone controls the biogenesis of L7Ae RNPs through conserved machinery.
Journal: J Cell Biol | Authors: Boulon Séverine S | Species: human | Application: WB - Assembly of the U5 snRNP component PRPF8 is controlled by the HSP90/R2TP chaperones.
Journal: J Cell Biol | Authors: Anna Malinová | Species: human | Application: WB - Proteomic and 3D structure analyses highlight the C/D box snoRNP assembly mechanism and its control.
Journal: J Cell Biol | Authors: Jonathan Bizarro | Species: human | Application: WB - Decoding the full picture of Raf1 function based on its interacting proteins.
Journal: Oncotarget | Authors: Ying Huang | Species: human | Application: WB - NEIL3-mediated proteasomal degradation facilitates the repair of cisplatin-induced DNA damage in human cells
Journal: Sci Rep | Authors: Umit Aliyaskarova | Species: human | Application: WB - Mechanism of the AAA+ ATPases pontin and reptin in the biogenesis of H/ACA RNPs.
Journal: RNA | Authors: Machado-Pinilla Rosario R | Species: mouse - RNA-binding proteins and heat-shock protein 90 are constituents of the cytoplasmic capping enzyme interactome.
Journal: J Biol Chem | Authors: Jackson B Trotman | Species: human | Application: WB - ASPH interacts with RUVBL2 to promote tumor metastasis in lung adenocarcinoma via MAPK and Notch signaling pathways.
Journal: Front Med | Authors: Chuhong Huang | Species: human | Application: IP - Nuclear receptor co-activator 4 interacts with RUVBL1/2 to maintain genome integrity through double-strand break repair.
Journal: DNA Repair (Amst) | Authors: Yingying Chen | Species: human | Application: WB - Anti-RuvBL1/2 Antibodies in Scleromyositis: A Clinicopathological Report of Two Cases.
Journal: ACR Open Rheumatol | Authors: Yuki Imai | Species: human | Application: WB,IP - HEATR1, a novel interactor of Pontin/Reptin, stabilizes Pontin/Reptin and promotes cell proliferation of oral squamous cell carcinoma.
Journal: Biochem Biophys Res Commun | Authors: Akihiko Nakamura | Species: human | Application: WB - Identification and characterization of R2TP in the development of oral squamous cell carcinoma.
Journal: Biochem Biophys Res Commun | Authors: Tetsuo Kiguchi | Species: human | Application: WB,IHC - WHSC1 Promotes Cell Proliferation, Migration, and Invasion in Hepatocellular Carcinoma by Activating mTORC1 Signaling.
Journal: Onco Targets Ther | Authors: Jingjing Dai | Species: human | Application: WB - Identification of RUVBL2 as a novel biomarker to predict the prognosis and drug sensitivity in multiple myeloma based on ferroptosis genes
Journal: Hematology | Authors: Sishi Tang | Species: human | Application: WB - PARP1-dependent recruitment of the FBXL10-RNF68-RNF2 ubiquitin ligase to sites of DNA damage controls H2A.Z loading.
Journal: Elife | Authors: Gergely Rona | Species: human | Application: IF - LINKIN, a new transmembrane protein necessary for cell adhesion.
Journal: Elife | Authors: Mihoko Kato | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
