SCF Recombinant monoclonal antibody, PBS Only 84118-2-PBS proteintech
$699.00
In stock
SKU
84118-2-PBS
| Catalog Number | 84118-2-PBS |
| Synonyms | KITLG, c Kit ligand, c-Kit ligand, KIT ligand, Kitl |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0112 Product name: Recombinant Human SCF protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 26-189 aa of BC074725 Sequence: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA Predict reactive species |
| Full Name | KIT ligand |
| Calculated Molecular Weight | 273 aa, 31 kDa |
| GenBank Accession Number | BC074725 |
| Gene Symbol | SCF |
| Gene ID (NCBI) | 4254 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P21583 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241365D7 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
