SLC22A15 Polyclonal antibody 20626-1-AP proteintech
$149.00
In stock
SKU
20626-1-AP
| Catalog Number | 20626-1-AP |
| Synonyms | Flipt 1, FLIPT1, Fly-like putative transporter 1, PRO34686, UNQ9429/PRO34686 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, A431 cells, human brain tissue, human heart tissue, human placenta tissue, human skeletal muscle tissue, L02 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Positive WB detected in | HEK-293 cells, A431 cells, human brain tissue, human heart tissue, human placenta tissue, human skeletal muscle tissue, L02 cells |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14547 Product name: Recombinant human SLC22A15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 431-535 aa of BC026358 Sequence: RVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK Predict reactive species |
| Full Name | solute carrier family 22, member 15 |
| Calculated Molecular Weight | 535aa,59 kDa; 547aa,61 kDa |
| Observed Molecular Weight | 61-66 kDa |
| GenBank Accession Number | BC026358 |
| Gene Symbol | SLC22A15 |
| Gene ID (NCBI) | 55356 |
| RRID | AB_10693537 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IZD6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for SLC22A15 antibody 20626-1-AP | Download protocol |
| human | WB Br J Cancer Deconvolution of haematological cancer methylation patterns reveals a predominantly non-disease related proliferation signal and uncovers true disease associated methylation changes. Authors - H Lalchungnunga View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:3000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Deconvolution of haematological cancer methylation patterns reveals a predominantly non-disease related proliferation signal and uncovers true disease associated methylation changes.
Journal: Br J Cancer | Authors: H Lalchungnunga | Species: human | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
