SLC25A11 Polyclonal antibody 12253-1-AP proteintech
$149.00
In stock
SKU
12253-1-AP
| Catalog Number | 12253-1-AP |
| Synonyms | alpha-oxoglutarate carrier, M2OM, Mitochondrial 2-oxoglutarate/malate carrier protein, OGC, OGCP |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Jurkat cells, human kidney tissue, HEK-293 cells, Raji cells |
| Tested Applications — Positive IP detected in | HEK-293 cells |
| Tested Applications — Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | Jurkat cells, human kidney tissue, HEK-293 cells, Raji cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2903 Product name: Recombinant human SLC25A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-314 aa of BC016294 Sequence: MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG Predict reactive species |
| Full Name | solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 |
| Calculated Molecular Weight | 314 aa, 34 kDa |
| Observed Molecular Weight | 28-34 kDa |
| GenBank Accession Number | BC016294 |
| Gene Symbol | SLC25A11 |
| Gene ID (NCBI) | 8402 |
| RRID | AB_2877840 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q02978 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SLC25A11 antibody 12253-1-AP | Download protocol |
| IHC protocol for SLC25A11 antibody 12253-1-AP | Download protocol |
| IP protocol for SLC25A11 antibody 12253-1-AP | Download protocol |
| WB protocol for SLC25A11 antibody 12253-1-AP | Download protocol |
| human | WB Cells SLC25A11 Is Associated with KDM2A-Dependent Reduction in rRNA Transcription Induced by Aminooxyacetic Acid. Authors - Yuji Tanaka KD Validated View Article |
| mouse,human | WB,IF Proc Natl Acad Sci U S A Mitochondrial outer membrane protein FUNDC2 promotes ferroptosis and contributes to doxorubicin-induced cardiomyopathy Authors - Na Ta KO Validated View Article |
| Citations | 9 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SLC25A11, also known as the mitochondrial 2-oxoglutarate/malate carrier protein (OGCP), is a member of the SLC25 solute carrier family. Localized to the inner mitochondrial membrane, the protein primarily catalyzes the electroneutral exchange of 2-oxoglutarate with dicarboxylates such as malate, thereby participating in key metabolic pathways including the malate-aspartate shuttle, gluconeogenesis, and nitrogen metabolism. Protocols Product Specific Protocols IF protocol for SLC25A11 antibody 12253-1-AP Download protocol IHC protocol for SLC25A11 antibody 12253-1-AP Download protocol IP protocol for SLC25A11 antibody 12253-1-AP Download protocol WB protocol for SLC25A11 antibody 12253-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- LINC00493-encoded microprotein SMIM26 exerts anti-metastatic activity in renal cell carcinoma
Journal: EMBO Rep | Authors: Kun Meng KD Validated | Species: human | Application: WB,IP,IF - METTL3-m6A-SLC25A11 Axis Promotes Chronic Hypoxia-Induced Cardiomyocyte Ferroptosis.
Journal: J Am Heart Assoc | Authors: Yansong Li KD Validated | Species: human | Application: WB - SLC25A11-mediated reprogramming of mitochondrial redox state and lipid peroxidation confers NRF2-dependent ferroptosis resistance in biliary tract cancer.
Journal: Cell Mol Biol Lett | Authors: Yu-Yu Lin KD Validated | Species: human | Application: IP,IHC,IF - SLC25A11 Is Associated with KDM2A-Dependent Reduction in rRNA Transcription Induced by Aminooxyacetic Acid.
Journal: Cells | Authors: Yuji Tanaka KD Validated | Species: human | Application: WB - Aspartate availability drives differential engagement of the malate-aspartate shuttle.
Journal: Mol Cell | Authors: Julia S. Brunner KO Validated | Species: mouse,human | Application: WB - Mitochondrial outer membrane protein FUNDC2 promotes ferroptosis and contributes to doxorubicin-induced cardiomyopathy
Journal: Proc Natl Acad Sci U S A | Authors: Na Ta KO Validated | Species: mouse,human | Application: WB,IF - LINC00493-encoded microprotein SMIM26 exerts anti-metastatic activity in renal cell carcinoma
Journal: EMBO Rep | Authors: Kun Meng | Species: human | Application: WB,IP,IF - METTL3-m6A-SLC25A11 Axis Promotes Chronic Hypoxia-Induced Cardiomyocyte Ferroptosis.
Journal: J Am Heart Assoc | Authors: Yansong Li | Species: human | Application: WB - SLC25A11, a Novel Gene Associated With Carney-Stratakis Syndrome
Journal: J Endocr Soc | Authors: Felipe Freitas-Castro | Species: human | Application: WB - Malate-aspartate shuttle inactivation drives pulmonary hypertension through glucose carbon flux rewiring and α-ketoglutarate-dependent epigenetic remodeling.
Journal: Redox Biol | Authors: Ying Wang | Species: mouse | Application: WB,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
