SLC25A39 Polyclonal antibody 14963-1-AP proteintech
$149.00
In stock
SKU
14963-1-AP
| Catalog Number | 14963-1-AP |
| Synonyms | CGI-69, Mitochondrial glutathione transporter SLC25A39, PRO2163, Solute carrier family 25 member 39 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF, ELISA |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, rat brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag6825 Product name: Recombinant human SLC25A39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC001398 Sequence: MADQDPAGISPLQQMVASGTGAVVTSLFMTPLDVVKVRLQSQRPSMASELMPSSRLWSLSYTKWKCLLYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGRALTSDLYAPMVAGALARLGTVTVISPLELMRTKLQAQHVSYRELGACVRTAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLNGFRPKDQTSVGMSFVAGGISGTVAAVLTLPFDVVKTQRQVALGAMEAVRVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFQRLNQDRLLGG Predict reactive species |
| Full Name | solute carrier family 25, member 39 |
| Calculated Molecular Weight | 39 kDa |
| Observed Molecular Weight | 37-39 kDa |
| GenBank Accession Number | BC001398 |
| Gene Symbol | SLC25A39 |
| Gene ID (NCBI) | 51629 |
| RRID | AB_2878095 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BZJ4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for SLC25A39 antibody 14963-1-AP | Download protocol |
| human | WB Nat Commun Combinatorial GxGxE CRISPR screen identifies SLC25A39 in mitochondrial glutathione transport linking iron homeostasis to OXPHOS. Authors - Xiaojian Shi View Article |
| Ashish (Verified Customer) (12-18-2023) | n/a Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: EWING SARCOMA CELL LINE |
| Citations | 15 |
| Dilutions | WB : 1:500-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SLC25A39, a member of the mitochondrial carrier family, is a mitochondrial transporter for basic amino acids localized to mitochondria. SLC25A39 can be expressed in human testis, kidney, heart, brain, liver and spleen. It has been reported that SLC25A39 is essential for heme biosynthesis in mammals. SLC25A29 is associated with mitochondrial protein synthesis and amino acid degradation. (PMID: 19656490, 11139402, 24652292) Protocols Product Specific Protocols WB protocol for SLC25A39 antibody 14963-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Radiotherapy promotes cuproptosis and synergizes with cuproptosis inducers to overcome tumor radioresistance
Journal: Cancer Cell | Authors: Guang Lei | Species: human | Application: WB - SLC25A39 is necessary for mitochondrial glutathione import in mammalian cells.
Journal: Nature | Authors: Ying Wang KO Validated | Species: human | Application: WB,IF - Autoregulatory control of mitochondrial glutathione homeostasis
Journal: Science | Authors: Yuyang Liu | Species: human | Application: WB - Copper Drives Remodeling of Metabolic State and Progression of Clear Cell Renal Cell Carcinoma
Journal: Cancer Discov | Authors: Megan E Bischoff | Species: human | Application: WB - SLC25A38 is required for mitochondrial pyridoxal 5'-phosphate (PLP) accumulation
Journal: Nat Commun | Authors: Izabella A Pena | Species: human | Application: WB - Combinatorial GxGxE CRISPR screen identifies SLC25A39 in mitochondrial glutathione transport linking iron homeostasis to OXPHOS.
Journal: Nat Commun | Authors: Xiaojian Shi | Species: human | Application: WB - S-Adenosyl-l-methionine restores brain mitochondrial membrane fluidity and GSH content improving Niemann-Pick type C disease
Journal: Redox Biol | Authors: Leire Goicoechea | Species: mouse | Application: WB - Dual regulation of SLC25A39 by AFG3L2 and iron controls mitochondrial glutathione homeostasis
Journal: Mol Cell | Authors: Xiaojian Shi | Species: human | Application: WB - Aberrant Mitochondrial Metabolism in Alzheimer's Disease Links Energy Stress with Ferroptosis
Journal: Adv Sci (Weinh) | Authors: Francesca Alves | Species: mouse | Application: WB - FGF21 maintains redox homeostasis and promotes neuronal survival after traumatic brain injury by targeting SLC25A39-mediated mitochondrial GSH transport.
Journal: J Transl Med | Authors: Lekai Wang | Species: mouse | Application: WB - DLAT sustains redox homeostasis and prevent colorectal cancer from ferroptosis by regulating SLC25A39-mediated mitochondrial glutathione transport.
Journal: Free Radic Biol Med | Authors: Kun Zhang | Species: human | Application: WB - SLC25A39 binds and modulates PRDX1 to suppress ROS-induced necroptosis in hepatocellular carcinoma.
Journal: Int Immunopharmacol | Authors: Wenxuan Liu - NFE2L2 and SLC25A39 drive cuproptosis resistance through GSH metabolism
Journal: Sci Rep | Authors: Jiao Liu | Species: human | Application: WB - Chronic Exposure to Arsenic and Fluoride Starting at Gestation Alters Liver Mitochondrial Protein Expression and Induces Early Onset of Liver Fibrosis in Male Mouse Offspring
Journal: Biol Trace Elem Res | Authors: Wendy L González-Alfonso | Species: mouse | Application: WB - SLC25A39: A Guardian against Cadmium-Induced Pleiotropic Disruption of Mitochondrial Homeostasis in Rat Neuronal Cells.
Journal: J Agric Food Chem | Authors: Li Wang - Cysteine excess triggers a mitochondrial iron-dependent cell death
Journal: Nat Metab | Authors: Toshitaka Nakamura | Species: human
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
