Serotonin transporter Polyclonal antibody 29186-1-AP proteintech
$149.00
In stock
SKU
29186-1-AP
| Catalog Number | 29186-1-AP |
| Synonyms | SLC6A4, 5 HTT, 5 HTTLPR, 5HTT, hSERT |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | SH-SY5Y cells, RAW 264.7 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | SH-SY5Y cells, RAW 264.7 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag30412 Product name: Recombinant human SLC6A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of NM_001045 Sequence: METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVD Predict reactive species |
| Full Name | solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 |
| Calculated Molecular Weight | 70 aa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | NM_001045 |
| Gene Symbol | Serotonin transporter |
| Gene ID (NCBI) | 6532 |
| RRID | AB_2935471 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P31645 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for Serotonin transporter antibody 29186-1-AP | Download protocol |
| mouse | WB,IHC Naunyn Schmiedebergs Arch Pharmacol Study on the therapeutic effects of the primary active ingredients in cinnamon oil for constipation-predominant irritable bowel syndrome and their regulatory effects on the 5-HT signaling pathway and gut microbiota. Authors - Wanqiu Peng View Article |
| Citations | 2 |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Serotonin transporter (SERT; SLC6A4) belongs to the sodium- and chloride-dependent monoamine transporter family. SERT is a membrane transporter that terminates the neurotransmission of serotonin, a monoaminergic neurotransmitter, through its reuptake. The SERT uptake mechanism acquires energy for active transport via ATP hydrolysis or via movement against electrochemical gradients. As an oligomeric N-glycan, SERT contains disulfide bonds between cysteine residues on the second extracellular domain. Post-translational modifications regulate the uptake kinetics and membrane trafficking of SERT, in part by regulating the proper folding and assembly of SERT in a host-dependent manner (PMID: 30394319). Protocols Product Specific Protocols WB protocol for Serotonin transporter antibody 29186-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Hyaluronic acid-ethylenediamine-cinnamic acid attenuates IBS-D via regulating 5-hydroxytryptamine signaling pathway, intestinal barrier and gut microbiota.
Journal: Int J Biol Macromol | Authors: Li Cui | Species: mouse | Application: WB - Study on the therapeutic effects of the primary active ingredients in cinnamon oil for constipation-predominant irritable bowel syndrome and their regulatory effects on the 5-HT signaling pathway and gut microbiota.
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Wanqiu Peng | Species: mouse | Application: WB,IHC
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
